Wikipedia:Basic English combined wordlist

From Simple English Wikipedia, the free encyclopedia

This list consists of

This list approximates a minimum English wordlist that a student can use to proceed on his own without difficulty.


This page is a list of words that come from a specific source and should not be changed.
Please do not add new items or make casual updates to it, unless you are correcting it to match its original source.


Top - 0-9 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z


A

Basic: aableaboutaccountacidacrossactadditionadjustmentadvertisementagreementafter • again • againstairall • almost • among • amountamusementangleanimalanswerandangryant • any • apparatusapple • approval • archargumentarmarmyartas • at • attackattemptattention • attraction • authorityautomaticawake

International: alcoholAlgebraaluminumammoniaanestheticAprilArithmeticasbestosAugust • autobus • automobile

Next: absence • absorptionacceleration • acceptance • accessory • accident • active • address • adjacent • adventure • adviceageagent • agency • ago • allowance • along • also • alternative • always • ambition • amplitudeanchorankle • appendage • applicationapproximation • arbitration • arbitraryarcarea • arrangement • ashasset • assistant • average • awkward • axis

Compound: afterthought • airplane • another • anybody • anyhow • anyone • anything • anywhere

Endings: actor • acting

B

Basic: babybackbadbagbalanceballbandbasebasinbasketbath • be • beautiful • because • bedbeebeforebehaviorbeliefbell • bent • berry • between • birdbirthbitbite • bitter • blackbladeblood • blow • blue • board • boatbodybonebookbootboilingbottleboxboybrainbrakebranchbrassbreadbreathbrickbridge • bright • broken • brotherbrownbrushbucketbuildingbulbbuttonburn • burst • business • but • butter • by

International: ballet • Bang • bankbarbeefbeerBiologybomb

Next: balcony • bale • bankruptbark • barrel • beakbeakerbeard • beat • behind • belt • bet • bill • birefringence • blame • blanket • both • bottom • brave • breakbreakfastbreast • broker • bubble • bud • budgetbuoyancy • bunch • burial • busy

Compound: backbone • backwoods • become • bedroom • beeswax • birthday • birthright • blackberryblackbirdblackboard • bloodvessel • bluebell • bookkeeper • brushwood • buttercup

Endings: basing • based • builder • burner • burned • burning

C

Basic: cakecameracanvascard • care • carriage • cart • cat • cause • certain • chainchalk • chance • change • cheap • cheesechemicalchest • chief • chinchurchcirclecloth • clean • clearclockcloudcoalcoatcold • collar • colorcomb • come • comfort • committeecommoncompanycomparisoncompetitioncomplete • complex • conditionconnection • conscious • controlcookcoppercopy • cord • corkcotton • cough • country • cover • cowcrack • credit • crime • cruel • crush • crycupcurrent • curtain • curvecushioncut

International: cafecalendar • catarrh • centi- • champagne • chauffeur • chemistChemistry • check • chocolatechoruscigarette • circus • citron • club • coffeecocktailcognacCollegecolony

Next: calculation • call • capacitycapitalcarpetcartilagecase • cast • cavecavitycell • ceremony • certificatechaircharacterchargechild • chimney • chinachoice • circulation • circuit • circumferencecivilizationclay • claim • claw • cleavage • clever • client • climber • clip • code • coil • collision • collection • column • combination • combine • communications • complaint • component • compoundconceptconcreteconductor • congruent • conservation • consignment • constantconsumer • continuous • contour • convenient • conversion • cool • corner • correlation • corrosioncostcourt • creeper • cropcross • cunning • cusp • customs

Compound: cardboard • carefree • caretaker • clockwork • commonsense • copyrightcupboard

Endings: carter • clothier • clothing • cooker • cooked • cooking • crying

D

Basic: damagedangerdarkdaughterdaydead • dear • deathdebtdecisiondeepdegree • delicate • dependent • designdesiredestruction • detail • development • different • digestiondirection • dirty • discovery • discussiondiseasedisgustdistance • distribution • division • do • dogdoordown • doubt • drain • drawer • dress • drink • driving • drop • drydust

International: danceDecember • deci- • degree • Dominion • dynamite

Next: damping • date • debit • deck • decrease • defect • deficiency • deflation • degenerate • delivery • demand • denominator • department • desertdensity • deposit • determining • dew • diameterdifference • difficulty • drift • dike • dilution • dinner • dip • direct • disappearance • discharge • discount • disgrace • dislike • dissipation • disturbance • ditch • dive • divisordivorce • doll • domesticating • dreadful • dream • duct • dull • duty

Compound: daylight • downfall

Endings: dancerdancing (to) • designer • dressing (up) • driver • dropped • dropper • duster

E

Basic: earearlyeartheastedgeeducation • effect • eggelasticelectricendengine • enough • equalerrorevenevent • ever • every • example • exchange • existence • expansion • experienceexperteye

International: eightelectricityelevenEmbassyEmpireencyclopediaengineer

Next: each • easyeconomy • efficiency • effort • either • elimination • employer • empty • enemyenvelopeenvironmentenvyequationerosioneruptionevaporation • evening • exact • excitement • experimentexerciseexplanationexplosionexport • expression • extinctioneyebroweyelash

Compound: ear-ring • earthwork • evergreen • everybody • everyday • everyone • everything • everywhere • eyeball

F

Basic: facefactfallfalsefamilyfarfarmfatfatherfearfeather • feeble • feeling • female • fertile • fictionfieldfightfingerfire • first • fish • fixed • flagflameflatflightfloorflowerfly • fold • foodfoolishfoot • for • forcefork • form • forward • fowl • frame • free • frequent • friend • from • front • fruit • full • future

International: Februaryfifteen • fifth • fiftyfivefourfourteen • fourth • fortyFriday

Next: factor • failure • fair • famousfan • fastening • fault • ferment • fertilizing • fever • fiber • figurefinfinancial • flash • flask • flesh • floodflourfocus • forecast • foreheadforeign • forgiveness • fractionfracture • fresh • frictionflintfloodflow • foliation • frost • frozen • fume • funnelfunnyfurfurnacefurniturefusion

Compound: fatherland • fingerprint • firearm • fire-engine • fireflyfiremanfireplacefirework • first-rate • football • footlights • footman • footnote • footprint • footstep

Endings: farmer • fisher/fisherman • folder • fired • firing

G

Basic: gardengeneral • get • girl • give • glassglovegogoatgoldgoodgovernmentgraingrass • great • greengrey/gray • grip • group • growth • guide • gun

International: gasGeographyGeologyGeometrygram • glycerin

Next: gategenerationgerm • germinating • gillglacierglandgod • grand • grateful • grating • gravel • grease • grief • grocerygroove • gross • ground • guard • guarantee • guess • gum

Compound: gasworks • goldfish • goodlooking • good-morning • goodnight • gunboat • gun-carriage • gunmetal • gunpowder

Endings: gardener

H

Basic: hairhammerhand • hanging • happyharbor • hard • harmonyhathate • have • hehead • healthy • hearingheartheathelp • here • highhistoryhole • hollow • hook • hope • hornhorsehospitalhourhouse • how • humor

International: half • hiss • hotelhundredhyenahygiene • hysteria

Next: habit • handkerchief • handle • heavy • hedge • hillhinge • hire • hold • holidayhome • honest • honey • hoof • host • humanhunt • hurry • hurt • husband

Compound: handbook • handwriting • headdress • headlandheadstone • headway • hereafter • herewith • highlands • highway • himself • horseplay • horsepower • hourglass • houseboat • housekeeper • however

Endings: hanger • heater • heated • heating

I

Basic: Iiceideaif • ill • important • impulsein • increase • industryinkinsectinstrumentinsuranceinterestinventionironisland

International: Imperial • inferno • influenzainternational

Next: igneous • imageimaginationimport • impurity • inclusion • index • individualinflationinfinityinheritanceinnocent • institution • insulatorintegerintelligent • intercept • interpretation • intersection • intrusion • investigation • investment • inverse • invitation

Compound: inasmuch • incomeindoors • inland • inlet • input • inside • instep • into • itself

Endings: inner

J

Basic: jellyjeweljoinjourneyjudgejump

International: JanuaryjazzJulyJune

Next: jam • jaw • jealous • jerkjoint • jug • juice • jury • justice

Endings: jeweler • joiner

K

Basic: keep • kettlekeykickkindkisskneeknifeknotknowledge

International: kilo- • King

Next: kennel • kidneykitchen • knock

Endings: keeper

L

Basic: landlanguage • last • late • laughlawleadleaflearning • least • leatherleg • less • left • let • letterlevellibraryliftlightlikelimitlinelinenlipliquidlistlittle • living • locklong • look • loose • loss • loud • lovelow

International: latitudelavaliterliqueurlongitude

Next: lace • lag • lake • lame • lamplargelatitudelawyer • layer • lazy • lecturelegallengthlenslessonleverlever • liability • license • lid • lifelimelimestonelinkliverload • local • load • loan • locus • longitudeluck • lump • lunch • lung

Compound: landmark • landslip • lighthouse • looking-glass

Endings: laughing (at) • learner • locker • locking (up)

M

Basic: machinemanmanager • make • malemapmarkmarket • married • match • materialmassmaymealmeasuremeatmedical • meeting • memorymetalmiddlemilitarymilkmindmineminute • mist • mixedmoneymonkeymonthmoon • more • morning • most • mothermotionmountainmouth • move • much • musclemusic

International: macaroni • madam • magnetic • malaria • mania • MarchMathematicsMaymetermeow • micro- • microscope • milli- • millionminuteMondayMuseum

Next: magicmagnitude • manner • many • marble • margin • marriagemast • mattress • mature • mean • meaning • medicinemediummelt • member • mess • message • metabolismmillmineralmixturemodel • modern • modest • momentummonopoly • mood • moralmoustachemud • multiple • multiplicationmurder

Compound: manhole • myself

Endings: marked • miner

N

Basic: nailnamenarrownationnaturalnearnecessaryneckneedneedlenervenetnewnewsnightnonoisenormalnorthnosenotnotenownumbernut

International: neutronnickelnicotinenineNovember

Next: nasty • naturenavy • neat • neglect • neighbornest • next • nice • node • nostril • nucleus • numerator • nurse

Compound: networknewspapernobody • nothing • nowhere

Endings: nearer • noted

O

Basic: observation • of • off • offer • officeoilold • on • only • open • operation • opinionopposite • or • orangeorderorganization • ornament • other • outoven • over • owner

International: Octoberolive • once • omeletoneopera • opium • orchestraorganism

Next: obedient • officerorchestraoreorgan • origin • outcrop • outlier • overlap • oval • own • oxidation

Compound: offspring • oncoming • oneself • onlooker • onto • outburst • outcome • outcry • outdoor • outgoing • outhouse • outlaw • outlet • outline • outlook • output • outside • outskirts • outstretched • overacting • overall • overbalancing • overbearing • overcoat • overcome • overdo • overdressed • overfull • overhanging • overhead • overland • overleaf • overloud • overseas • overseer • overshoe • overstatement • overtake • overtaxed • overtime • overturned • overuse • overvalued • overweight • overworking

Endings: outer

P

Basic: pagepainpaintpaperparallel • parcel • part • past • paste • payment • peacepenpencilpersonphysicalpicturepigpinpipeplaceplaneplantplateplay • please • pleasureplough/plowpocketpointpoisonpolishpolitical • poor • porter • positionpossiblepotpotatopowderpower • present • price • print • prisonprivate • probable • process • produce • profitproperty • prose • protestpublic • pull • pump • punishmentpurpose • push • put

International: pajamas • paraffin • paradisepark • passport • patentpenguinpetroleum • phonograph • PhysicsPhysiologypianoplatinumpolice • post • potashPresidentPrincePrincessprogrampropagandaPsychology • Purr • pyramid

Next: packing • pad • pair • panparagraphparentparticle • partner • party • passage • path • patience • pedal • pendulum • pensionpeople • perfect • petal • piston • plain • plan • plaster • plug • poetry • pollen • poolpopulationporcelain • practice • praise • prayerpressure • prick • priest • prime • probabilityproductprogress • projectile • projectionpromiseproofproudpulleypupil • purchase • pure

Compound: pincushion • plaything • policeman • postman • postmark • postmaster • postoffice

Endings: painterpainting • parting • playing • played • pleased (with) • pointer • pointing (at) • potter • printerprisonerproducer

Q

Basic: qualityquestionquickquiet • quite

International: Quack • quarterQueen • quinine

Next: quantityquotient

R

Basic: rail • rain • range • rat • rate • rayreactionredreading • ready • reasonreceiptrecord • regret • regular • relationreligion • representative • request • respect • responsible • rest • rewardrhythmricerightringriverroad • rod • roll • roof • room • root • rough • round • rub • rule • run

International: radioradiumreferendumrestaurant • rheumatism • Royal • rum

Next: raceradiationratio • reagent • real • receiver • reciprocalrectangle • recurring • reference • reflux • reinforcement • relative • remark • remedy • rent • repair • reproduction • repulsion • resistance • residue • resolutionresult • retail • revenge • reversible • rich • rigidity • rise • rival • rock • rot • rotation • rude • rust

Compound: runaway

Endings: raining • reader • reading • roller • rulerrubber

S

Basic: sadsafesailsaltsamesand • say • scaleschoolsciencescissorsscrewsea • seat • secondsecretsecretaryseeseed • selection • self • send • seem • sense • separate • serious • servantsexshade • shake • shame • sharpsheepshelfshipshirtshockshoeshort • shut • sidesignsilksilversimplesistersizeskinskirtskysleep • slip • slope • slow • smallsmashsmellsmilesmoke • smooth • snakesneezesnow • so • soapsocietysocksoftsolid • some • sonsong • sort • soundsoupsouthspacespadespecialspongespoonspringsquarestagestampstar • start • statement • stationsteamsteel • stem • step • stick • sticky • stiff • still • stitch • stocking • stomachstonestopstorestorystraight • strange • street • stretch • strong • structuresubstance • such • sudden • sugarsuggestionsummersunsupport • surprise • sweetswimsystem

International: saladsardineSaturdaysecondSeptember • serum • seven • sir • sixsixteensportSunday

Next: sac • sale • sample • satisfaction • saturated • saucer • saving • scale • scarp • schist • scratch • screenseal • search • security • secretion • section • sedimentary • selfish • sensitivity • sentence • sepal • servicesetshadow • shale • share • shave • shear • sheet • shell • shore • shouldershowsight • sill • similarity • since • skull • slate • sleeveslidesocialsoilsoldiersolution • solvent • sorry • spark • specialization • specimen • speculationspirit • spit • splash • spot • stable • stain • stair • stalk • stamen • statistics • steady • stimulus • storm • strain • straw • streamstrengthstress • strike • stringstudysubject • substitution • subtraction • success • successive • sucker • sumsupplysurface • surgeon • suspension • suspicious • swelling • swing • switch • sympathetic

Compound: seaman • secondhand • shorthandsideboard • sidewalk • somebody • someday • somehow • someone • something • sometime • somewhat • somewhere • suchlike • sunburnsunlight • sunshade • sweetheart

Endings: sailor • shocking • shocked • snowing • steamer • stopper • stopping • stopping up • stretcher

T

Basic: tabletail • take • talk • tall • tastetaxteaching • tendency • test • than • that • the • then • theory • there • thick • thin • thingthis • though • thought • thread • throat • through • thumbthunderticket • tight • tired • till • timetintotoe • together • tomorrowtonguetoothtoptouchtowntradetraintransporttraytreetricktrouserstrue • trouble • turn • twist

International: tapioca • taxitea • telegram • telephoneten • terrace • theaterthermometer • third • thirteenthirtythousandthreeThursdaytoasttobacco • torpedo • Tuesdayturbine • twenty-one • twelvetwenty • twice • two

Next: tailor • tame • tap • tear • tentterm • texture • thickness • thief • thimble • thorax • threatthrusttidetietissue • tongs • too • total • toweltowertraffictragedy • transmission • transparent • trap • travel • treatment • triangletrucktube • tune • tunneltwin • typist

Compound: today • tonight • tradesman

Endings: talking (of) • teacher • touching (up) • trader • trainer • training • troubling • troubled • turning (over)

U

Basic: umbrellaunderunitup • use

International: university

Next: ugly • unconformity • understandinguniverse • unknown

Compound: underclothing • undercooked • undergo • undergrowth • undermined • undersigned • undersized • understatement • undertake • undervalued • undo • upkeep • uplift • upon • upright • uptake

Endings: used (to)

V

Basic: value • verse • very • vesselviewviolentvoice

International: vanillaviolinvisavitaminvodkavolt

Next: valencyvalley • valve • vaporvariable • vascular • vegetablevelocity • vestigial • victim • victory • volume • vortex • vote

Compound: viewpoint

W

Basic: walkwall • waiting • warwarmwashwastewatchwaterwavewax • way • weatherweekweightwellwestwet • what • wheel • when • where • which • while • whipwhistlewhite • who • why • widewillwindwindowwinewingwinterwirewise • with • womanwoodwoolwordworkworm • wound • writingwrong

International: Wednesday • whisky

Next: weak • wedge • welcome • whether • wholesale • widow • wife • wild • world • wreck • wrist

Compound: waterfallweekend • well-being • well-off • whatever • whenever • whereas • whereby • wherever • whichever • whitewash • whoever • windpipe • within • without • woodwork • workhouse

Endings: waiterworker • working (on) working (out) / working (up) • writer • waiting • wasted

X, Y, Z

Basic: yearyellowyesyesterdayyouyoung

International: zebrazincZoology

Next: yawn

Compound: x-ray • yearbook • yourself • zookeeper