MediaWiki mediawikiwiki https://www.mediawiki.org/wiki/MediaWiki MediaWiki 1.47.0-wmf.19 first-letter Media Special Talk User User talk Project Project talk File File talk MediaWiki MediaWiki talk Template Template talk Help Help talk Category Category talk Thread Thread talk Summary Summary talk Manual Manual talk Extension Extension talk API API talk Skin Skin talk TimedText TimedText talk Module Module talk Translations Translations talk Event Event talk Topic Newsletter Newsletter talk 4 1428 8598514 8596977 2026-09-10T00:16:35Z ~2026-48744-00 18509985 8598514 wikitext text/x-wiki gf7xjykg4ddb8h7n2l701s04v0muwmc 8598516 8598514 2026-09-10T00:45:33Z Hazard-Bot 560685 Bot: Automatically cleaned 8598516 wikitext text/x-wiki ni8p3ypkq39hxrmit1g3300saroa1mk 8598810 8598516 2026-09-10T10:49:46Z Officer Jayson 18510299 PERSONAL LIBLATORY 20222411 8598810 wikitext text/x-wiki kv4j6pf6b3y3x32w8lheh2kwaww4di2 8598818 8598810 2026-09-10T10:54:26Z Clump 81610 Reverted edits by [[Special:Contribs/Officer Jayson|Officer Jayson]] ([[User talk:Officer Jayson|talk]]) to last version by Hazard-Bot 8598516 wikitext text/x-wiki ni8p3ypkq39hxrmit1g3300saroa1mk 12 6092 8598801 8595383 2026-09-10T10:34:01Z Msaditech 18507330 /* */ 8598801 wikitext text/x-wiki s1yy7ehk3wz90n72o72irup3ehke1gi 8598802 8598801 2026-09-10T10:36:02Z Veritas Sapientiae 17658810 Reverted edits by [[Special:Contribs/Msaditech|Msaditech]] ([[User talk:Msaditech|talk]]) to last version by Shirayuki: test edits, please use the [[Project:Sandbox|sandbox]] 8595383 wikitext text/x-wiki tjdh8rx15q5szs0mmqmnduo1iwhowkx 8598805 8598802 2026-09-10T10:45:00Z Msaditech 18507330 /* */ 8598805 wikitext text/x-wiki avjbwp7cqdh48sh92wwuxn3l2equ6i1 8598806 8598805 2026-09-10T10:46:06Z Veritas Sapientiae 17658810 Reverted edits by [[Special:Contribs/Msaditech|Msaditech]] ([[User talk:Msaditech|talk]]) to last version by Veritas Sapientiae: unexplained content removal 8595383 wikitext text/x-wiki tjdh8rx15q5szs0mmqmnduo1iwhowkx 100 11999 8598525 8595568 2026-09-10T03:39:15Z Samwilson 10510 Move GraphicsMagick into new 'Custom command' section. Clarify other parts, and link etc. 8598525 wikitext text/x-wiki bptjelw4lczrft638yk2bom2gghqqan 102 12870 8598819 8199389 2026-09-10T11:19:37Z SomeRandomDeveloper 18020465 $wgFlaggedRevsTagsAuto was removed 8598819 wikitext text/x-wiki gmcnpr9ig9w7tbi9dtscvgqd1cab1xi 100 18172 8598547 8186698 2026-09-10T07:27:45Z Zpehey 18163979 removed a nignx config dead link and put the github archived version of it 8598547 wikitext text/x-wiki 4dvatit0zsev3r3q4lgpcp3dlis9b20 101 19639 8598528 8310312 2026-09-10T04:52:26Z ~2026-48914-57 18510099 8598528 wikitext text/x-wiki jcm78o4rfre2a6vu9dsub0bh0ha64on 8598529 8598528 2026-09-10T04:52:40Z Divinations 18009523 Reverted edits by [[Special:Contribs/~2026-48914-57|~2026-48914-57]] ([[User talk:~2026-48914-57|talk]]) to last version by Clump 7694079 wikitext text/x-wiki apfep0nuk7p0xmlzvn7beajobz7k5sz 12 20848 8598795 8555759 2026-09-10T09:32:33Z AromaTake 2087904 8598795 wikitext text/x-wiki svsz9q4wffyssp24o9x86ibaix7vv6f 100 31231 8597929 8492278 2026-09-09T14:46:42Z Sebastian Berlin (WMSE) 5908593 /* Upload security */ Add instructions for missing module 8597929 wikitext text/x-wiki 9j4uoqeqjel5tcmnbuvbmfm33zqrbox 100 36576 8598267 8492480 2026-09-09T22:46:00Z FuzzyBot 451990 Updating to match new version of source page 8598267 wikitext text/x-wiki 7u0tmu1x5mfnbo3vxg09unshf1bfdm0 100 36862 8598272 8492486 2026-09-09T22:46:04Z FuzzyBot 451990 Updating to match new version of source page 8598272 wikitext text/x-wiki mcnm9pmj2k1frpx7aegz2e8p96tcwn2 0 36931 8598542 8543460 2026-09-10T06:08:12Z Cscott 814786 /* Linking a developer checkout of Parsoid */ Make a note about unit tests and the autoloader hack. 8598542 wikitext text/x-wiki pgv6n6iojrnsroj6qmvfxtyodlr6vzr 10 41210 8598015 5787144 2026-09-09T18:54:53Z Tgr (WMF) 1127507 Undid revision [[Special:Diff/5787144|5787144]] by [[Special:Contributions/ExE Boss|ExE Boss]] ([[User talk:ExE Boss|talk]]): remove Loops module, it is spewing errors ("Lua error in package.lua at line 80: module 'Module:Exponential search' not found.") and it's marked as alpha so probably shouldn't be used in a popular template. 8598015 wikitext text/x-wiki 9tabore5f22gsm0v9q5b55jz03i1db2 0 45185 8598059 8596580 2026-09-09T19:44:45Z Mechi4895 18319167 /* Implement lossless JPG transformations in the Commons Android App */ 8598059 wikitext text/x-wiki aec33flcp1pjze5yjz5pw6wm665xxui 100 58990 8598264 8492478 2026-09-09T22:45:59Z FuzzyBot 451990 Updating to match new version of source page 8598264 wikitext text/x-wiki 2nkbqgsk72a51y3j2ubizuqm33oqxpv 100 74251 8598530 6515335 2026-09-10T04:53:24Z SuperPikaPool13 1942718 /* Parameters */ adding this option to the table too since the prose can be missed by someone skimming the page and looking only at the table 8598530 wikitext text/x-wiki er419o87y67letq66xig6qadni73uxw 8598531 8598530 2026-09-10T04:53:42Z SuperPikaPool13 1942718 8598531 wikitext text/x-wiki jbw1gr4qchg17c916sceygyxowc40mv 100 93847 8598591 8178798 2026-09-10T08:18:22Z Nirmos 326917 8598591 wikitext text/x-wiki 1spdnd9lurjg290p0uz754alvq5lvu5 100 97259 8598257 8492470 2026-09-09T22:45:54Z FuzzyBot 451990 Updating to match new version of source page 8598257 wikitext text/x-wiki bz6hxs4gtcn4qn9gr6ahyir1b3lo7jy 0 114093 8597712 8363759 2026-09-09T12:02:25Z Elcapitan68 11087975 Improved note for my record (Anton Krom) 8597712 wikitext text/x-wiki kv6drnamekg3o1tv66f0qa0cyn73sng 100 321126 8597755 8596945 2026-09-09T12:27:17Z Kghbln 189117 Undid revision [[Special:Diff/8596945|8596945]] by [[Special:Contributions/Gabonnie|Gabonnie]] ([[User talk:Gabonnie|talk]]) sounds unnecessarily formal and awkward 8597755 wikitext text/x-wiki s6h0iypmbjaaytm8buss9bzf6pvg1x2 100 332388 8597758 8597245 2026-09-09T12:27:27Z FuzzyBot 451990 Updating to match new version of source page 8597758 wikitext text/x-wiki ayndlwcllorzo8jaqtu8ixbbysvhryx 100 332527 8597757 8597246 2026-09-09T12:27:27Z FuzzyBot 451990 Updating to match new version of source page 8597757 wikitext text/x-wiki py07v4l5gf3eyc4ekbtz3imtiytdeyz 100 332834 8597763 8597251 2026-09-09T12:27:30Z FuzzyBot 451990 Updating to match new version of source page 8597763 wikitext text/x-wiki 0tgao8njwwgppz2ayweyx3lu9941ohd 100 332837 8597761 8597249 2026-09-09T12:27:29Z FuzzyBot 451990 Updating to match new version of source page 8597761 wikitext text/x-wiki ji2m45ctsstq8dmd2s666ddci47ge1b 0 340261 8597962 8596989 2026-09-09T18:13:21Z Crystal-bot 5243179 Bot: Updating project taxonomy 8597962 wikitext text/x-wiki 0q6xidzsdwktk6ozxb2a38bgs64vze5 8598545 8597962 2026-09-10T06:13:18Z Crystal-bot 5243179 Bot: Updating project taxonomy 8598545 wikitext text/x-wiki ssbu6b8vlqwuwgknldkrytzl0pc1sy4 0 445097 8598018 8525710 2026-09-09T19:05:29Z EBlackorby-WMF 18109000 added page 8598018 wikitext text/x-wiki p3moktee4e9orwyk73tmkmr8y2hodcl 12 520152 8598715 8594657 2026-09-10T09:12:37Z HanV 6324917 Created page with "Verplaatst naar wfGetDB" 8598715 wikitext text/x-wiki l2o5f9dk13zzfg3kdjf3v1c8zj0sgck 8598719 8598715 2026-09-10T09:12:54Z HanV 6324917 Created page with "Experimentele ondersteuning voor een hulpknop "Vraag"." 8598719 wikitext text/x-wiki h4nwsx2s1qcwd39fn1gmbqcisr80bdw 8598725 8598719 2026-09-10T09:13:12Z HanV 6324917 Created page with "Misschien verandert het later in een "hook"." 8598725 wikitext text/x-wiki c4smy7hiakrrrbvky8fl9fjjagqpzzz 8598731 8598725 2026-09-10T09:13:52Z HanV 6324917 Created page with "Dit is een array met de keys page, URL en params." 8598731 wikitext text/x-wiki m46krdndxtsjq4gbgjotej3g6iyshq8 8598733 8598731 2026-09-10T09:14:10Z HanV 6324917 Created page with ""page" is een titel van een lokale wiki-pagina" 8598733 wikitext text/x-wiki aph9jbm19yk5937u18mapqcfvky1fqd 8598737 8598733 2026-09-10T09:14:28Z HanV 6324917 8598737 wikitext text/x-wiki 6rci6erprnq4r19ruvx1gof8wr5dsux 8598741 8598737 2026-09-10T09:15:09Z HanV 6324917 Created page with ""url" is een URL om te gebruiken zoals is (bijvoorbeeld een probleemtracker indien-formulier) die de pagina zal overschrijven indien ingesteld" 8598741 wikitext text/x-wiki ayad1d2wjj6cnrarq89omjp0w1alfkg 8598743 8598741 2026-09-10T09:16:03Z HanV 6324917 Created page with ""params" is een array van sleutel-waardeparen van meegegeven parameters" 8598743 wikitext text/x-wiki iel62z9y5br4xcxah1yxz5wk2mkdmyo 8598745 8598743 2026-09-10T09:16:18Z HanV 6324917 Created page with "elke parameterwaarde kan de variabele $1 bevatten die wordt vervangen door de volledige pagina-naam." 8598745 wikitext text/x-wiki j6bj65mlvjaygprt0eqn7jcwja52fue 8598747 8598745 2026-09-10T09:16:32Z HanV 6324917 Created page with "Als $1, maar voor een specifieke namespace." 8598747 wikitext text/x-wiki b0t9rtj0cq2gyu1vg970cnuxmlvodah 8598749 8598747 2026-09-10T09:17:11Z HanV 6324917 Created page with "Elk $2-achtig array moet de waarde zijn die wordt toegewezen aan de numerieke ID van een namespace van de wiki." 8598749 wikitext text/x-wiki 84erkxcsykm81o4s7ilnurd73w8sn9c 8598771 8598749 2026-09-10T09:19:31Z HanV 6324917 Created page with "Wanneer niet-geprivilegeerde gebruikers een vertalingseditor openen, zien zij een bericht waarin staat dat er een speciale toestemming nodig is voor het vertalen van berichten. Als deze variabele wordt gedefinieerd, is er een knop die de gebruiker naar die pagina brengt om toestemming te vragen." 8598771 wikitext text/x-wiki sf9cnurspj6vhm5v8q2r1vbngra094p 8598773 8598771 2026-09-10T09:20:09Z HanV 6324917 Created page with "Het doel moet worden herhaald met de tweede variabele om hetzelfde resultaat te krijgen met de zandbak geactiveerd waar gebruikers de zandbak niet kunnen betreden." 8598773 wikitext text/x-wiki iu034tibiq9wwrht8996umzdhvzd0um 8598779 8598773 2026-09-10T09:21:09Z HanV 6324917 Created page with "Indien ingesteld, geeft het een waarschuwing weer en laat het de gebruiker niet toe om vertaalbare pagina's met meer subpagina's dan deze waarde te verplaatsen" 8598779 wikitext text/x-wiki if8cegpnkipo4fo0hq8ludy82s3dt24 8598783 8598779 2026-09-10T09:21:45Z HanV 6324917 Created page with "De pagina vertaalfunctie inschakelen." 8598783 wikitext text/x-wiki 0eyaljayaena8snfq2iyveha9f8cu58 8598785 8598783 2026-09-10T09:23:14Z HanV 6324917 Created page with "De functie paginavertaling maakt gestructureerde vertaling van wiki-pagina's met eenvoudige markering mogelijk met het automatisch volgen van wijzigingen." 8598785 wikitext text/x-wiki rnmr83epoh0gliy6dbo5fy148oe82xa 8598787 8598785 2026-09-10T09:23:37Z HanV 6324917 Created page with "Nummer voor de namespace Translations." 8598787 wikitext text/x-wiki lhd7hlzmplgpeqo2w6pmndjmk6y29m2 8598789 8598787 2026-09-10T09:23:48Z HanV 6324917 Created page with "Wijzig dit als het in conflict komt met andere namespaces in uw wiki." 8598789 wikitext text/x-wiki ijf6g8yhgpzq4nd1dus7p9d36dm7cn2 100 554752 8598259 8492474 2026-09-09T22:45:55Z FuzzyBot 451990 Updating to match new version of source page 8598259 wikitext text/x-wiki oee6qa543v81wryc9hnq57isk7ebpte 100 555460 8598270 8492484 2026-09-09T22:46:03Z FuzzyBot 451990 Updating to match new version of source page 8598270 wikitext text/x-wiki n232mpzai20wu8vs0rbf1u98y06onpt 100 609735 8598276 8492490 2026-09-09T22:46:07Z FuzzyBot 451990 Updating to match new version of source page 8598276 wikitext text/x-wiki 4a2rfagyd1b7zyxw78fo8q92ly9lvmp 100 628561 8598263 8492477 2026-09-09T22:45:58Z FuzzyBot 451990 Updating to match new version of source page 8598263 wikitext text/x-wiki 4wtzwinv35oiwvowknns4apxiylu2k0 100 634520 8598261 8492475 2026-09-09T22:45:57Z FuzzyBot 451990 Updating to match new version of source page 8598261 wikitext text/x-wiki 6n8oie1kadyxpqjdq19dc6jk5hwaedw 0 706391 8598543 8090871 2026-09-10T06:08:37Z ~2026-48997-89 18510130 /* Technical Advice IRC Meetings will not continue in 2020 */ 8598543 wikitext text/x-wiki 9z5sphwa6ey32pd9t6e57pyekil24u2 8598544 8598543 2026-09-10T06:12:44Z Divinations 18009523 Reverted edits by [[Special:Contribs/~2026-48997-89|~2026-48997-89]] ([[User talk:~2026-48997-89|talk]]) to last version by Clump 8004918 wikitext text/x-wiki l3bxwp32kjyh4llygpg92fj1pkzuzb9 100 740699 8597946 7793608 2026-09-09T16:56:46Z 臺灣象象 18139173 8597946 wikitext text/x-wiki bq39uktmzu2wbhiwney5xx7513imajh 1198 740703 8597945 2635343 2026-09-09T16:56:45Z 臺灣象象 18139173 8597945 wikitext text/x-wiki grtjkm1yer6yk8eny67nl391gg81njr 100 799830 8598271 8492487 2026-09-09T22:46:03Z FuzzyBot 451990 Updating to match new version of source page 8598271 wikitext text/x-wiki j2b4c0m2lp4x7fcy41ndvoryj0o67os 0 808326 8598902 8577487 2026-09-10T11:43:42Z ~2026-48964-66 18510319 8598902 wikitext text/x-wiki s4yjzcqzrn08fjt9bbtx57e80o7myt9 0 832542 8597729 8363769 2026-09-09T12:23:57Z FuzzyBot 451990 Updating to match new version of source page 8597729 wikitext text/x-wiki 0s2ygxctabtt3ik54zbzbxulac2eyg4 0 832544 8597738 8363777 2026-09-09T12:24:05Z FuzzyBot 451990 Updating to match new version of source page 8597738 wikitext text/x-wiki 5sriuil39ai3eq19zbufbps0ggo7dnm 0 837913 8597726 8363767 2026-09-09T12:23:54Z FuzzyBot 451990 Updating to match new version of source page 8597726 wikitext text/x-wiki 1ayibsbsy815lab992zek2axvkye23l 100 846199 8598266 8492481 2026-09-09T22:46:00Z FuzzyBot 451990 Updating to match new version of source page 8598266 wikitext text/x-wiki 251fembwvjk092mh6hhxtqtp9hqud06 0 871779 8597742 8363783 2026-09-09T12:24:10Z FuzzyBot 451990 Updating to match new version of source page 8597742 wikitext text/x-wiki 7fqgancel1fubjkbda6kgcovit8l9nn 0 873156 8597743 8503556 2026-09-09T12:24:11Z FuzzyBot 451990 Updating to match new version of source page 8597743 wikitext text/x-wiki 55ta2i76iv3rht9x8jpfr2vexmvt9mq 100 908154 8597759 8597247 2026-09-09T12:27:28Z FuzzyBot 451990 Updating to match new version of source page 8597759 wikitext text/x-wiki jx9i0ol8it9pee9d49csuu2j6xgmlvt 0 912283 8597749 8363790 2026-09-09T12:24:18Z FuzzyBot 451990 Updating to match new version of source page 8597749 wikitext text/x-wiki i1zo8kvecluy7upk9swdwl7qujq1wge 0 914703 8597725 8380819 2026-09-09T12:23:53Z FuzzyBot 451990 Updating to match new version of source page 8597725 wikitext text/x-wiki lrmd6hto7l23cmnvvrha449h6a4iwuo 10 916233 8598539 8402050 2026-09-10T06:02:07Z ~2026-48993-70 18510137 8598539 wikitext text/x-wiki j5erq7w79gvjgb4rwdag2jzfq36lrxd 8598541 8598539 2026-09-10T06:02:49Z Divinations 18009523 Reverted edits by [[Special:Contribs/~2026-48993-70|~2026-48993-70]] ([[User talk:~2026-48993-70|talk]]) to last version by MathXplore 8598541 wikitext text/x-wiki 57y1zsyjigtqxjwcn7apd0fvi86rttv 1198 916730 8598538 7795748 2026-09-10T06:02:06Z ~2026-48993-70 18510137 8598538 wikitext text/x-wiki 5xii4t0uxdrswbir5rcx9kuus5e1luc 8598540 8598538 2026-09-10T06:02:48Z Divinations 18009523 Reverted edits by [[Special:Contribs/~2026-48993-70|~2026-48993-70]] ([[User talk:~2026-48993-70|talk]]) to last version by MathXplore 5719270 wikitext text/x-wiki 3tcs0i5mlwlqwvxbxw6b2donmo1ju9w 0 916954 8597724 8363766 2026-09-09T12:23:50Z FuzzyBot 451990 Updating to match new version of source page 8597724 wikitext text/x-wiki hb57j1b3bl5vxr33dxitumm36pinj77 1198 953024 8598120 4593056 2026-09-09T21:14:20Z TheBigOveis 18509913 8598120 wikitext text/x-wiki ehgy9ayfa2slfnuq3c526g5gwrseyfy 8598123 8598120 2026-09-09T21:15:29Z Clump 81610 Reverted edits by [[Special:Contribs/TheBigOveis|TheBigOveis]] ([[User talk:TheBigOveis|talk]]) to last version by Alfa80 4593056 wikitext text/x-wiki 2umyttzihv02rp7q8fzxgyq99xm2578 10 953025 8598121 8570819 2026-09-09T21:14:21Z TheBigOveis 18509913 8598121 wikitext text/x-wiki el8o75jw4lc6pu1oxioksgx1s6rtnar 8598125 8598121 2026-09-09T21:15:30Z Clump 81610 Reverted edits by [[Special:Contribs/TheBigOveis|TheBigOveis]] ([[User talk:TheBigOveis|talk]]) to last version by Alfa80 8598125 wikitext text/x-wiki m1c5m4lggcv508kzqypn3ezsbcn2rq5 8598127 8598125 2026-09-09T21:15:54Z Clump 81610 Reverted edits by [[Special:Contribs/TheBigOveis|TheBigOveis]] ([[User talk:TheBigOveis|talk]]) to last version by Clump 8598127 wikitext text/x-wiki jnygkp5chrj89jcfohlbd3qc9bkuv8o 1198 953027 8598124 7928119 2026-09-09T21:15:29Z TheBigOveis 18509913 8598124 wikitext text/x-wiki gv1f4ne4bfurl9sgncd6abtj1zhgdz8 8598126 8598124 2026-09-09T21:15:53Z Clump 81610 Reverted edits by [[Special:Contribs/TheBigOveis|TheBigOveis]] ([[User talk:TheBigOveis|talk]]) to last version by Clump 4495442 wikitext text/x-wiki 8urbnats2kiqa9zumqr9z38i9k9jdfm 12 956235 8598677 8596743 2026-09-10T09:10:28Z Wladek92 887141 protect not translatable reserved words 8598677 wikitext text/x-wiki 2wv0n8qsby22bjzend0uvpo72d7arzg 8598678 8598677 2026-09-10T09:10:44Z Wladek92 887141 Marked this version for translation 8598678 wikitext text/x-wiki dvnwn950a6gomshu35g3lpde7e8s3co 100 961527 8598258 8492472 2026-09-09T22:45:54Z FuzzyBot 451990 Updating to match new version of source page 8598258 wikitext text/x-wiki 5p5jbxcju0uxcwwot2vg6zqdzcwzyu9 0 965369 8597747 8363789 2026-09-09T12:24:16Z FuzzyBot 451990 Updating to match new version of source page 8597747 wikitext text/x-wiki k0y8jgnzqnkubxfz4xwc0xtjqodefn5 0 966342 8597730 8363771 2026-09-09T12:23:57Z FuzzyBot 451990 Updating to match new version of source page 8597730 wikitext text/x-wiki jalzasdqjj6ym6vkdfyej99dld94540 0 1009960 8597741 8468125 2026-09-09T12:24:09Z FuzzyBot 451990 Updating to match new version of source page 8597741 wikitext text/x-wiki 13ibow7m38s5xa28hahmvqh7bl9b4ri 0 1012514 8597745 8387695 2026-09-09T12:24:14Z FuzzyBot 451990 Updating to match new version of source page 8597745 wikitext text/x-wiki 0c0pvf2d6k68vhvajkzmmdbnnhbm9h3 0 1029636 8597740 8363781 2026-09-09T12:24:08Z FuzzyBot 451990 Updating to match new version of source page 8597740 wikitext text/x-wiki f8k3p38gezwz55o55op5v8bmmaphu02 1198 1035247 8597756 8597242 2026-09-09T12:27:25Z FuzzyBot 451990 Importing a new version from external source 8597756 wikitext text/x-wiki mjdm668jg1ib2bwg7l88b6tcn888e5z 0 1105398 8598199 8501518 2026-09-09T22:29:31Z IJuulia 17387949 8598199 wikitext text/x-wiki 040rmk1oqjtz9rdqij3dwh5f8ep9hzh 8598201 8598199 2026-09-09T22:30:02Z IJuulia 17387949 8598201 wikitext text/x-wiki 5qi2jldjrin0naet7mevcwinzww70fk 8598203 8598201 2026-09-09T22:30:14Z IJuulia 17387949 8598203 wikitext text/x-wiki d003yw014i9k4jy6yhz4x5cizc7yn41 8598205 8598203 2026-09-09T22:32:00Z IJuulia 17387949 Created page with "* Um '''script de usuário''' pode ser editado pelo autor original (se estiver armazenado no namespace <code>Usuário:</code>) e por qualquer um com a permissão de usuário "$1" (normalmente apenas administradores de interface)." 8598205 wikitext text/x-wiki 1ufryhswi253wchygeuupgg6gl9zg0d 8598207 8598205 2026-09-09T22:33:48Z IJuulia 17387949 Created page with "O código normalmente é hospedado numa subpágina da [[$1|sua página de usuário]]." 8598207 wikitext text/x-wiki a6ht9a1m3wcz1bz2x5tsfljm2fyf5z3 8598209 8598207 2026-09-09T22:34:27Z IJuulia 17387949 Created page with "Exemplos incluem: $2 e [[m:en:User:Hooman/useful links.js]]." 8598209 wikitext text/x-wiki 7dm4099scyfmi28tw7b7030wudixa4x 8598211 8598209 2026-09-09T22:36:38Z IJuulia 17387949 Created page with "Scripts de usuário são parecidos com as páginas de [[$3|JavaScript]] pessoais como $3, mas eles permitem que blocos de código isolados sejam compartilhados com outros usuários." 8598211 wikitext text/x-wiki bre955i07u0d6ypxycwlggsb2j90xkx 8598213 8598211 2026-09-09T22:36:53Z IJuulia 17387949 8598213 wikitext text/x-wiki 414nfdwi3x2gquu9xaewefuggm6rd86 8598215 8598213 2026-09-09T22:38:40Z IJuulia 17387949 8598215 wikitext text/x-wiki f7x07jdi9jwgp67ga6mi08ke1fy87dl 8598217 8598215 2026-09-09T22:39:53Z IJuulia 17387949 8598217 wikitext text/x-wiki 6x4nnnd28ncz9kat1dvv4pf48y99lp1 8598219 8598217 2026-09-09T22:40:05Z IJuulia 17387949 Created page with "Administradores de interface podem editá-los." 8598219 wikitext text/x-wiki 5a3oayi3sgdhmhtdvanpq0v1cwvhtlt 8598221 8598219 2026-09-09T22:40:32Z IJuulia 17387949 Created page with "Consulte $2 para mais informações." 8598221 wikitext text/x-wiki 2g9dfyrj0q9rjoeiq6wfe8rhls6ylam 8598223 8598221 2026-09-09T22:40:56Z IJuulia 17387949 8598223 wikitext text/x-wiki 3uoor0zatyassxy0kedywmkuz5of7z8 8598225 8598223 2026-09-09T22:41:19Z IJuulia 17387949 Created page with "== Escreva seu primeiro ''script'' de usuário ==" 8598225 wikitext text/x-wiki 9oz8t2wdoo4ib6eui5ok9m838zkfk2r 8598227 8598225 2026-09-09T22:41:56Z IJuulia 17387949 Created page with "Nessa seção, você cria um exemplo de ''script'' de usuário que calcula o tempo de leitura estimado de uma página wiki." 8598227 wikitext text/x-wiki a6iiu9k8tk4fpdch9brit0z143qpxvd 8598229 8598227 2026-09-09T22:42:39Z IJuulia 17387949 Created page with "Certifique-se de [[$1|entrar em sua conta]]." 8598229 wikitext text/x-wiki 600om052wnuwl4mit6ouesc32u2mebw 8598231 8598229 2026-09-09T22:42:48Z IJuulia 17387949 Created page with "Acesse $1." 8598231 wikitext text/x-wiki hkz5vusks9hrmv8l5f8ruh4301c2cpo 8598233 8598231 2026-09-09T22:43:38Z IJuulia 17387949 Created page with "Essa página armazenda seu [[$1|JavaScript pessoal]] que é carregado em toda visualização de página (exceto $2)." 8598233 wikitext text/x-wiki kxhaw4jq0wiigb9h24pm02jd6h7qb0c 8598235 8598233 2026-09-09T22:44:00Z IJuulia 17387949 Created page with "Crie a página ou edite a página se ela já existir." 8598235 wikitext text/x-wiki 4gc2h62e9kncti8mobnagq2odiieqq7 8598237 8598235 2026-09-09T22:44:13Z IJuulia 17387949 Created page with "Copie as seis linhas seguintes e cole-as na página:" 8598237 wikitext text/x-wiki m2wlcig9f0c07zbde18ehw846ix6ikk 8598239 8598237 2026-09-09T22:44:20Z IJuulia 17387949 Created page with "Clique em $1." 8598239 wikitext text/x-wiki qw86jruslrs2x66vif3t1vahck3lhmi 8598241 8598239 2026-09-09T22:44:36Z IJuulia 17387949 Created page with "Vá para qualquer página. Observe o título." 8598241 wikitext text/x-wiki lqkcf5daqep76ulsm3zrr1gxy4bseof 8598243 8598241 2026-09-09T22:44:51Z IJuulia 17387949 Created page with "Esse exemplo de ''script'' de usuário foi retirado de $1." 8598243 wikitext text/x-wiki qubcvje2wfmoe5v0cfm0liezajduq8s 8598245 8598243 2026-09-09T22:45:11Z IJuulia 17387949 Created page with "Há mais exemplos de ''scripts'' de usuário simples nessa página." 8598245 wikitext text/x-wiki rkh4zip7a0h7ye1hk20r9mp4w90ivpk 8598247 8598245 2026-09-09T22:45:23Z IJuulia 17387949 Created page with "== Um exemplo de ''script'' de usuário mais complexo ==" 8598247 wikitext text/x-wiki t7ln0q3j22vmcxkr27z3gz2nlm7abnd 8598278 8598247 2026-09-09T22:47:10Z IJuulia 17387949 Created page with "Consulte $1 que usa $2 do ResourceLoader, a API de ação do MediaWiki, uma caixa de diálogo do ''jQuery UI'', ''jQuery AJAX'', e vínculo de eventos ''jQuery''." 8598278 wikitext text/x-wiki 6lv2j0izkrl55ayjcmhvm95cq32dj6m 8598280 8598278 2026-09-09T22:48:06Z IJuulia 17387949 Created page with "Copie e cole o conteúdo da página [[MediaWiki:Tutorial-QuickRC.js]] na sua [[Special:MyPage/common.js]]." 8598280 wikitext text/x-wiki 55hq94ppiy17gbjyibr1llof36o84c4 8598283 8598280 2026-09-09T22:50:57Z IJuulia 17387949 Created page with "O resultado será o mesmo que o acima, mas agora você pode modificar o ''script'', brincar com ele, e trocá-lo totalmente por outra coisa." 8598283 wikitext text/x-wiki a7p1sv8pk88mfvlxiuu2ns395nxdr0n 8598285 8598283 2026-09-09T22:52:42Z IJuulia 17387949 Created page with "Ao clicar em "Pré-visualizar" (ou usando o atalho de teclado, normalmente $1) no editor, a última versão do ''script'' será executada. Essa é uma boa maneira de navegar sem salvar a página. Lembre-se que nada é salvo até clicar em "Publicar"." 8598285 wikitext text/x-wiki 12169tmy81s21r68vctor74zvc2kkbm 8598287 8598285 2026-09-09T22:52:57Z IJuulia 17387949 Created page with "== Carregar um ''script'' de usuário existente ==" 8598287 wikitext text/x-wiki 9g39wcmaivct7h68sry755ymy060ggf 8598289 8598287 2026-09-09T22:53:09Z IJuulia 17387949 Created page with "Na seção anterior, você copiou o conteúdo de um ''script'' de usuário." 8598289 wikitext text/x-wiki 2j75s6f56rgvu4yp3gtd5s76v0oelhm 8598291 8598289 2026-09-09T22:53:29Z IJuulia 17387949 Created page with "Nessa seção, você irá carregar o ''script'' $1 já existente." 8598291 wikitext text/x-wiki 6y9915hhvn7zak8thtilmoes9a4ka3e 8598293 8598291 2026-09-09T22:53:36Z IJuulia 17387949 Created page with "Certifique-se de [[$1|entrar em sua conta]]." 8598293 wikitext text/x-wiki ix4zrh0f0627ge9k2amvvbeu48jq8n1 8598295 8598293 2026-09-09T22:53:39Z IJuulia 17387949 Created page with "Acesse $1." 8598295 wikitext text/x-wiki 6yu34dyx3skxsjr6gr3xb7okawku5l9 8598297 8598295 2026-09-09T22:53:51Z IJuulia 17387949 Created page with "Essa página armazena seu [[$1|JavaScript pessoal]] que é carregado em toda visualização de página (exceto $2)." 8598297 wikitext text/x-wiki h5zq4ka5j3urutssb0p855vxhacc40b 8598299 8598297 2026-09-09T22:54:16Z IJuulia 17387949 8598299 wikitext text/x-wiki 22pbbxnstw82wz5wn1sl1wop2z58bxq 8598301 8598299 2026-09-09T22:54:47Z IJuulia 17387949 8598301 wikitext text/x-wiki 7bczyjxv9k9nnu253ord74q239xpapd 8598303 8598301 2026-09-09T22:55:24Z IJuulia 17387949 8598303 wikitext text/x-wiki 8cemolq9eaxjrb0u7w223xo4axs5m7h 8598305 8598303 2026-09-09T22:55:47Z IJuulia 17387949 8598305 wikitext text/x-wiki mrln745p863u8lrzdghy6fghixnxsdn 8598307 8598305 2026-09-09T22:56:04Z IJuulia 17387949 8598307 wikitext text/x-wiki 7vdqkngv000vgctklehn3gn4gwx1dgp 8598309 8598307 2026-09-09T22:56:46Z IJuulia 17387949 8598309 wikitext text/x-wiki 40malxdqv5pu62o1agm7ad9dk9g8a1u 8598311 8598309 2026-09-09T22:57:21Z IJuulia 17387949 8598311 wikitext text/x-wiki sdn247npshjlgnnerr93jesvdmxfx7e 8598313 8598311 2026-09-09T22:57:27Z IJuulia 17387949 8598313 wikitext text/x-wiki ht8uotm3g3r4cvqp1lhrmuuimvtj930 8598315 8598313 2026-09-09T22:57:34Z IJuulia 17387949 Created page with "Crie a página ou edite a página se ela já existir." 8598315 wikitext text/x-wiki mp75nreekccjb7ovp2to25aox5cl9u5 8598317 8598315 2026-09-09T22:57:58Z IJuulia 17387949 Created page with "Copie o seguinte texto e cole-o na página:" 8598317 wikitext text/x-wiki cjvlyaowadsgn8xj4qehn6joh4mdy0h 8598319 8598317 2026-09-09T22:58:45Z IJuulia 17387949 Created page with "Clique em "Publicar alterações". Você terá agora um ''link'' na seção de "Ferramentas" chamado "Histórico rápido"." 8598319 wikitext text/x-wiki qhy7crfsb5srpi0i5zxd1izs73qvoo1 8598321 8598319 2026-09-09T22:59:06Z IJuulia 17387949 Created page with "Clique em "Histórico rápido". Você receberá uma janela ''pop-up''." 8598321 wikitext text/x-wiki ho5fr6ufz1zd4fwo9vgbtbsen0lgqek 8598323 8598321 2026-09-09T23:00:05Z IJuulia 17387949 Created page with "Ela mostra um pedaço das [[$1|últimas alterações]] dessa página." 8598323 wikitext text/x-wiki af7oltof4gbzztrf05ubcthssjulcix 8598325 8598323 2026-09-09T23:00:22Z IJuulia 17387949 Created page with "=== Usar um ''script'' em outra wiki da Wikimedia ===" 8598325 wikitext text/x-wiki 7o0gvuq261xwkvdqzbk8s2hkjimiwb0 8598327 8598325 2026-09-09T23:02:09Z IJuulia 17387949 Created page with "Se você quiser usar um ''script'' em outro website da Wikimedia (por exemplo, a Wikipédia em português ao invés da MediaWiki.org), você pode executar os mesmos passos anteriores: você pede ao ResourceLoader que carregue seu código. Acesse seu [[w:Special:MyPage/common.js|common.js]] na Wikipédia em português e adicione o seguinte:" 8598327 wikitext text/x-wiki 9brb35ce70dtayfkbri960amn6iwzgt 8598329 8598327 2026-09-09T23:04:07Z IJuulia 17387949 Created page with "Você também pode carregar o ''script'' de usuário que você acabou de criar anteriormente, ao mudar <code>MediaWiki:Tutorial-QuickRC.js</code> na linha anterior para <code>Usuário:''SeuNome''/''SeuScript''.js</code> (substitua <code>''SeuNome''</code> e <code>''SeuScript''</code> de acordo)." 8598329 wikitext text/x-wiki sii6dw15tn617gndk1av17r05gsfell 8598331 8598329 2026-09-09T23:05:22Z IJuulia 17387949 Created page with "Esse primeiro requer que você não armazene o código de seu ''script'' de usuário na própria $1 e sim numa subpágina separada na sua [[$2|página de usuário]]." 8598331 wikitext text/x-wiki av410z1lgjdcvzq65h1hw7ld12b1kg5 8598333 8598331 2026-09-09T23:06:18Z IJuulia 17387949 Created page with "Isso também permite [[$1|concentrar o código em um único local, para que você tenha que atualizar o código apenas em um local]]." 8598333 wikitext text/x-wiki emxy011q8coe6ncrbzigt83cxjxyg7y 8598335 8598333 2026-09-09T23:07:32Z IJuulia 17387949 Created page with "Essa seção lista recursos que são necessários ou auxiliares para ''scripts'' de usuário mais complexos." 8598335 wikitext text/x-wiki slp85gfu6bqsom31432fb37am4skfd7 8598337 8598335 2026-09-09T23:07:47Z IJuulia 17387949 8598337 wikitext text/x-wiki qur8sjj27ns8tg5hdj57aj51p4s1h8a 8598339 8598337 2026-09-09T23:10:38Z IJuulia 17387949 Created page with "$1 é um recurso principal do MediaWiki que disponibiliza ativos de JavaScript e CSS para usuários e leitores de maneira inteligente. Uma vez que ''Gadgets'' são escritos em JavaScript, como um desenvolvedor de ''Gadget'', você estará propenso a interagir com o ResourceLoader." 8598339 wikitext text/x-wiki lwxq5uj0adzd9sog7x0rvgsoq2yghyj 8598341 8598339 2026-09-09T23:11:07Z IJuulia 17387949 Created page with "Seu ''gadget'' deverá carregar módulos úteis do ResourceLoader." 8598341 wikitext text/x-wiki kjg3dtu78ze0jfvhgrfzrl13osywj3i 8598343 8598341 2026-09-09T23:12:01Z IJuulia 17387949 Created page with "* [[$modules|Módulos]] — Uma lista de bibliotecas JavaScript, plugins jQuery e utilitários do MediaWiki pré-existentes no ResourceLoader para você reutilizar." 8598343 wikitext text/x-wiki lyq21wufurz5shifkbtt5zmek1gt1b7 8598346 8598343 2026-09-09T23:12:29Z IJuulia 17387949 8598346 wikitext text/x-wiki ee3coubuemf4q1uw99x9v44rliyv309 8598348 8598346 2026-09-09T23:12:38Z IJuulia 17387949 8598348 wikitext text/x-wiki jw36ji183pei20qjd33b8bcuud33vd6 8598350 8598348 2026-09-09T23:13:05Z IJuulia 17387949 Created page with "'''Codex''' é o {{$2|sistema de design}} oficial para $1." 8598350 wikitext text/x-wiki 8t3ng4n05c1bp64hv6rzdke0k4tl0z8 8598352 8598350 2026-09-09T23:15:28Z IJuulia 17387949 Created page with "Ele fornece uma gama de ferramentas unificadas, diretrizes e componentes para auxiliar programadores e designers a desenvolver interfaces de usuário consistentes, [[$1|acessíveis]] e [[$2|localizadas]] em volta dos projetos Wikimedia." 8598352 wikitext text/x-wiki t8rz6tx2ieq3nrhdrtp1l2teok2i78k 8598354 8598352 2026-09-09T23:15:53Z IJuulia 17387949 8598354 wikitext text/x-wiki aya23sjla7z456ayrekdlzlclrfm0nc 8598356 8598354 2026-09-09T23:16:35Z IJuulia 17387949 Created page with "Dentro do contexto de um website MediaWiki, a API de ação pode ser acessada por meio de JavaScript através da JavaScript API $1." 8598356 wikitext text/x-wiki h9v4mis0r5cen7o7wxtnk3ysywtfemd 8598358 8598356 2026-09-09T23:16:43Z IJuulia 17387949 Created page with "($1 para requisições entre-sites permitidas, por exemplo, entre wikis da família Wikimedia.)" 8598358 wikitext text/x-wiki 395qwp23u6regb5jmh4w0i4zeve2zx8 8598360 8598358 2026-09-09T23:18:56Z IJuulia 17387949 Created page with "Se seu ''gadget'' faz requisições API diretamente, adicione o parâmetro $callback para a API URL se você estiver tentando fazer uma requisição API que violaria a [[w:same-origin-policy|política de mesma origem]] (por exemplo, ao fazer uma requisição ao Commons API da Wikipédia). Isso aciona o uso de [[w:JSONP|JSONP]] e reitera certas [[$restrict|restrições]]." 8598360 wikitext text/x-wiki scct32rea062tue3lixfe494v8vjs7s 8598362 8598360 2026-09-09T23:19:31Z IJuulia 17387949 Created page with "Consulte [[VisualEditor/Gadgets]] para um tutorial especificamente para ''gadgets'' do [[VisualEditor]]." 8598362 wikitext text/x-wiki oba9avnpwepkkr6d1p9od3xu046qtdj 8598364 8598362 2026-09-09T23:19:49Z IJuulia 17387949 Created page with "=== Depuração de ''scripts'' de usuário e ''gadgets'' ===" 8598364 wikitext text/x-wiki pojtgczebid7q7vxsync7lyzkuz7mr8 8598366 8598364 2026-09-09T23:20:10Z IJuulia 17387949 Created page with "''Gadgets'' são normalmente compactados pelo ResourceLoader, minimizados e agregados." 8598366 wikitext text/x-wiki r1bge5x328lg0oamvswktjb8as001vh 8598368 8598366 2026-09-09T23:21:13Z IJuulia 17387949 Created page with "Utilize o parâmetro URI $5 (precedido por $3 ou $4, obviamente), para requisitar a versão não-compactada da sua página e carregar a "versão original" de seu ''gadget''." 8598368 wikitext text/x-wiki bjsb2bs85kdrw5xsx9vdp1448ylav28 8598370 8598368 2026-09-09T23:21:37Z IJuulia 17387949 Created page with "Consulte também [[$1|Desenvolvimento com o ResourceLoader]] para mais informações." 8598370 wikitext text/x-wiki rt16jt86khiqawvuzfu998z5aimho7b 8598372 8598370 2026-09-09T23:22:05Z IJuulia 17387949 Created page with "Aprenda como usar as Ferramentas de Desenvolvedor do seu navegador (por exemplo, como desabilitar cache no seu navegador)." 8598372 wikitext text/x-wiki hyta8dofifyo58eauk7msv3uv6xswy9 8598374 8598372 2026-09-09T23:22:47Z IJuulia 17387949 Created page with "Veja a documentação correspondente: [$1 Chrome/Chromium], [[$2|Firefox]], [$3 Internet Explorer], [$4 Opera], [$5 Safari]." 8598374 wikitext text/x-wiki 5n7dqrqi6xcbxbu6vi9yb8nox8xgq6z 8598377 8598374 2026-09-09T23:23:37Z IJuulia 17387949 Created page with "Se um ''gadget'' existente tiver problemas, você também pode utilizar a página [[Especial:Gadgets]] para encontrar a localização do código-fonte de um ''gadget''." 8598377 wikitext text/x-wiki m81pj0slurllp5zk27o51xe27xbmybo 8598379 8598377 2026-09-09T23:23:46Z IJuulia 17387949 Created page with "=== Privacidade e conteúdo externo ===" 8598379 wikitext text/x-wiki lo4e4df4ohx28gmmqwayd27tm6mcju1 8598381 8598379 2026-09-09T23:24:38Z IJuulia 17387949 Created page with "Você não deve carregar recursos externos que podem ferir a privacidade dos usuários. Nas wikis da Wikimedia, os seguintes domínios são considerados seguros:" 8598381 wikitext text/x-wiki 776rn1s9mwb96zic3yifx0mvhoghb3p 8598383 8598381 2026-09-09T23:26:06Z IJuulia 17387949 Created page with "''Havia'' uma tarefa do [[$1|Jenkins]] ([[$2|código]] da [$url tarefa]) que automaticamente verificava ''gadgets'' por este motivo, mas essa tarefa não têm sido executada ativamente desde 2022." 8598383 wikitext text/x-wiki 2ekjv48k9uuslq9r4hpo28v1dpy2ce6 8598385 8598383 2026-09-09T23:26:20Z IJuulia 17387949 Created page with "=== Execução de código no carregamento de páginas ===" 8598385 wikitext text/x-wiki 1q9llftiz5plbjuduezcn4uq6wzkr8l 8598387 8598385 2026-09-09T23:27:31Z IJuulia 17387949 Created page with "A tarefa comum de executar código assim que uma página é carregada tem diversas armadilhas que até mesmo editores experientes caem." 8598387 wikitext text/x-wiki miyfw80skqpfoz8vsld3x26q21h7mea 8598389 8598387 2026-09-09T23:27:55Z IJuulia 17387949 Created page with "Primeiramente, quando seu código trabalha com elementos da DOM, execute-o no carregamento da página." 8598389 wikitext text/x-wiki 03jsdtzqmbu4gdt2k2sue4xal5jbbvw 8598391 8598389 2026-09-09T23:28:22Z IJuulia 17387949 Created page with "Caso contrário, seu código pode executar cedo demais." 8598391 wikitext text/x-wiki imqfw64d16mqrzz28jiy86lelcp6e1x 8598393 8598391 2026-09-09T23:28:52Z IJuulia 17387949 Created page with "O jeito mais comum de fazer isso é usando a função $1 do jQuery, que faz a mesma coisa que $2." 8598393 wikitext text/x-wiki r7sfsfh3euamaehddphituu3usiahmh 8598395 8598393 2026-09-09T23:29:17Z IJuulia 17387949 Created page with "Porém, se seu código funciona com a parte de conteúdo da página (o elemento $1), você deve usar o ''hook'' $2." 8598395 wikitext text/x-wiki hap9haouo34t2lmca33tk84zg3oe3wi 8598397 8598395 2026-09-09T23:30:11Z IJuulia 17387949 Created page with "Desta maneira, seu código irá reprocessar a página com sucesso quando for atualizada assicronamente e o ''hook'' for ativado novamente." 8598397 wikitext text/x-wiki r16xi4xf00usm6gupghj6qso8txp6m7 8598399 8598397 2026-09-09T23:31:05Z IJuulia 17387949 Created page with "Há diversas ferramentas que fazem isso, que vão de pré-visualização de edição para atualização automática da lista de páginas vigiadas." 8598399 wikitext text/x-wiki a541ji1waso5n1isoerqic1x1vfx5vv 8598401 8598399 2026-09-09T23:32:07Z IJuulia 17387949 Created page with "Certifique-se de apenas trabalhar com os descendentes do elemento $1 que sua função manipuladora utiliza e não a página inteira." 8598401 wikitext text/x-wiki odh31ib1navy8g43zymyjuxtj1hdiny 8598403 8598401 2026-09-09T23:32:26Z IJuulia 17387949 Created page with "Caso contrário, você pode acabar executando o mesmo código para os mesmos elementos várias vezes." 8598403 wikitext text/x-wiki td4dwgu6hwlw160wg5hy4oz11k2w6i4 8598405 8598403 2026-09-09T23:32:51Z IJuulia 17387949 Created page with "Perceba que o ''hook'' $1 pode ser ativado várias vezes." 8598405 wikitext text/x-wiki hw2iwflz04m8prl7f67it1adkuahe5q 8598407 8598405 2026-09-09T23:33:12Z IJuulia 17387949 Created page with "Tenha cuidado com o que vem no argumento $1 da função manipuladora." 8598407 wikitext text/x-wiki fv9p3qlv0zxf6jvaylii8k51jhmylcb 8598409 8598407 2026-09-09T23:33:30Z IJuulia 17387949 Created page with "Você não deve presumir que é o elemento $1." 8598409 wikitext text/x-wiki 08pnj43ki5akmwmkfhdwi2exnu39w92 8598411 8598409 2026-09-09T23:33:50Z IJuulia 17387949 Created page with "Pode ser uma porção pequena da página, por exemplo, quando é pré-visualizada." 8598411 wikitext text/x-wiki ic9epsq5kungpgdbfk8i8dkztbu1gkm 8598413 8598411 2026-09-09T23:34:27Z IJuulia 17387949 Created page with "Código que trabalha com o conteúdo da página e evita as armadilhas previamente mencionadas se parecem com isso:" 8598413 wikitext text/x-wiki 992gcm0oqgrgi4fswlyh2dcd8r39ufz 8598415 8598413 2026-09-09T23:34:35Z IJuulia 17387949 Created page with "Faça as coisas com $target" 8598415 wikitext text/x-wiki 3maooa98m2attmgdt2yb0lprklp8a1f 8598417 8598415 2026-09-09T23:35:03Z IJuulia 17387949 Created page with "Apenas execute algumas operações quando for #mw-content-text em um argumento" 8598417 wikitext text/x-wiki 420j0j48umz9mwvsbxd4svd8p7bbeoh 8598419 8598417 2026-09-09T23:38:37Z IJuulia 17387949 Created page with "Se seu código trabalha com o conteúdo da página e adiciona manipuladores de evento aos elementos da DOM, ao invés de usar hooks em $1 e buscar por elementos para anexar ouvintes de eventos (''event listeners'') à ele ao ser ativado, você pode usar ''delegação de evento'': anexe um ouviente de evento a um elemento fora da área de conteúdo ou o $2 inteiro mas filtre eventos por um seletor (consulte a [$3 documentação do jQuery])." 8598419 wikitext text/x-wiki grzbdvoxnj22xy4shdymyc7djjuqplg 8598421 8598419 2026-09-09T23:38:51Z IJuulia 17387949 Created page with "Isto é, ao invés de escrever $1, você pode escrever $2." 8598421 wikitext text/x-wiki dogwg7acvgz6fofuq5uz6wdeolybg8l 8598423 8598421 2026-09-09T23:39:05Z IJuulia 17387949 Created page with "=== Métricas de gravação ===" 8598423 wikitext text/x-wiki ns80zkwuu3pqal8nnttihlufewl6jcz 8598425 8598423 2026-09-09T23:39:27Z IJuulia 17387949 Created page with "Alguns ''gadgets'' são negócios sérios." 8598425 wikitext text/x-wiki csq954zbqs4bqegpmztulftpjtj2ac5 8598427 8598425 2026-09-09T23:40:37Z IJuulia 17387949 Created page with "Quando seu ''gadget'' fica sério, você pode querer utilizá-lo como instrumento para propósitos analíticos, por exemplo, para medir a taxa de cliques de elementos específicos da UI adicionados em uma página pelo ''gadget''." 8598427 wikitext text/x-wiki a3tmlhoa0lpxbzetqgdldgyja7ol2uq 8598429 8598427 2026-09-09T23:40:51Z IJuulia 17387949 Created page with "=== Diversos ===" 8598429 wikitext text/x-wiki o0p31prky6o9k5xsbuylighpc1l7mhs 8598431 8598429 2026-09-09T23:41:49Z IJuulia 17387949 Created page with "Código de ''gadget'' não precisa seguir [[$jsconv|as convenções de código JavaScript]] para MediaWiki, mas se você espera que outros mexam no seu código, elas podem ser usadas como referência." 8598431 wikitext text/x-wiki rvrfhmiem7at98kwuq6skkjuzfoj4h8 8598433 8598431 2026-09-09T23:43:37Z IJuulia 17387949 Created page with "Se você estiver desenvolvendo em uma [[w:pt:IDE]] como o [[w:pt:VS Code]], você pode usar definições de tipo para [https://www.npmjs.com/package/types-mediawiki MediaWiki], [https://www.npmjs.com/package/@types/oojs OOjs], [https://www.npmjs.com/package/@types/oojs-ui OOUI], e [https://www.npmjs.com/package/@types/jquery jQuery] para [[w:Code completion|preenchimento automático de código]] e [[w:type checking|checagem de tipo]]." 8598433 wikitext text/x-wiki 792q8rnk8uymsjmlpff344fgfchwwjl 8598435 8598433 2026-09-09T23:43:49Z IJuulia 17387949 Created page with "== Desvantagens e problemas de ''gadgets'' ==" 8598435 wikitext text/x-wiki qzu0590ark6blod38e93l2kyg2yno1y 8598437 8598435 2026-09-09T23:44:04Z IJuulia 17387949 Created page with "''Gadgets'' são desenvolvidos por membros da comunidade." 8598437 wikitext text/x-wiki e4l0i12jsg0l8k02u9ur6rhnaw5514f 8598439 8598437 2026-09-09T23:44:39Z IJuulia 17387949 Created page with "Até hoje, não é necessário que haja revisão formal de código para ''gadgets'' nos sites da Wikimedia (veja $1)." 8598439 wikitext text/x-wiki k460u4zx1lfe331mjk4znzxcpdh9g9s 8598441 8598439 2026-09-09T23:45:02Z IJuulia 17387949 Created page with "Por favor, siga as boas práticas listadas nessa página." 8598441 wikitext text/x-wiki sw72mxadb4tqmeli0m88axfbon29nrf 8598443 8598441 2026-09-09T23:45:55Z IJuulia 17387949 Created page with "Em sites Wikimedia, o processo de "promover" um ''script'' de usuário para um ''gadget'' na seção de [[$1|"''Gadgets''"]] nas preferências de usuário não é sempre clara." 8598443 wikitext text/x-wiki fumpkdq5yuulhba25fm5vz1w5t503sz 8598445 8598443 2026-09-09T23:46:51Z IJuulia 17387949 Created page with "Você terá que encontrar um [[$1|administrador de interface]] e talvez tenha que fornecer instruções de ''deploy'' para ele." 8598445 wikitext text/x-wiki la5lyv9cn58koi4udexmqg3gy76h3pu 8598447 8598445 2026-09-09T23:47:26Z IJuulia 17387949 Created page with "A Wikimedia não possui um processo sistemático para reutilização, modificação e contribuição de ''scripts'' de usuário e ''gadgets'' pré-existentes." 8598447 wikitext text/x-wiki t40x9ctpxsgborf9lpg9lnnpzjeh2jx 8598449 8598447 2026-09-09T23:47:45Z IJuulia 17387949 Created page with "== Sugestões de trabalho ==" 8598449 wikitext text/x-wiki rtqmitxywclvx65o9ktdtd5bv3w56mj 8598451 8598449 2026-09-09T23:48:12Z IJuulia 17387949 Created page with "Alguns membros da comunidade da Wikimedia podem comparitlhar suas ideias e o que eles gostariam de ver implementados por outras pessoas." 8598451 wikitext text/x-wiki sjp3ji9rut9a69kd3yxeewx17y2luux 8598453 8598451 2026-09-09T23:48:31Z IJuulia 17387949 Created page with "Você pode fazer pequenos arranjos em ''gadgets'' existentes, ou trabalhar em propostas" 8598453 wikitext text/x-wiki elp4q7qtlk3frdc45mbxkvoirh6rzh1 8598455 8598453 2026-09-09T23:48:47Z IJuulia 17387949 Created page with "não é uma página popular, então pode ser que você perca tempo" 8598455 wikitext text/x-wiki 12yigx8m7zd99rtm1lll0vew37339zp 8598457 8598455 2026-09-09T23:49:04Z IJuulia 17387949 Created page with "[[w:Wikipedia:User scripts/Requests|Pedidos]]" 8598457 wikitext text/x-wiki oe0cpssx87suwsnszbhp9uctqk7608u 8598459 8598457 2026-09-09T23:49:16Z IJuulia 17387949 Created page with "para a Wikipédia em inglês" 8598459 wikitext text/x-wiki 7lvoq0gy5pj2vjh1uoeneo1zjhnc0fp 8598461 8598459 2026-09-09T23:49:39Z IJuulia 17387949 Created page with "== Fazendo ''deploy'' ou ativando um ''gadget'' ==" 8598461 wikitext text/x-wiki ftli9cmjl6dwqijav0zw4dvr7htmi13 8598463 8598461 2026-09-09T23:50:20Z IJuulia 17387949 Created page with "Se seu ''script'' de usuário deveria virar um ''gadget'' (veja as [[$1|definições]] acima) em uma wiki, os seguintes passos são necessários:" 8598463 wikitext text/x-wiki dcr48teufb8niuat0eca3bvdu0o7hm9 8598465 8598463 2026-09-09T23:50:28Z IJuulia 17387949 Created page with "Passos para o autor do ''script'':" 8598465 wikitext text/x-wiki amewryoksq6jjxlva2g9suh4rf78sf1 8598467 8598465 2026-09-09T23:50:49Z IJuulia 17387949 Created page with "Recrute um desenvolvedor experiente para revisar seu código." 8598467 wikitext text/x-wiki 64fryedo2j78tqd9oh4a0vypocmywov 8598469 8598467 2026-09-09T23:50:58Z IJuulia 17387949 Created page with "Não há processo formal para fazer isso." 8598469 wikitext text/x-wiki gpe0nau4bu4npdppngy35l026cug6i3 8598471 8598469 2026-09-09T23:51:29Z IJuulia 17387949 Created page with "Verifique com membros da comunidade se não há nenhum problema com ativar o ''gadget'' em uma wiki" 8598471 wikitext text/x-wiki ebfyadhm1mm7k6mpzqw55ik2o3rv37v 8598473 8598471 2026-09-09T23:51:34Z IJuulia 17387949 8598473 wikitext text/x-wiki mxg69ya2d3clice5tgjahcrqfocxt4h 8598475 8598473 2026-09-09T23:52:03Z IJuulia 17387949 Created page with "Para o próprio website MediaWiki.org, isso seria [[Project:Village Pump]]." 8598475 wikitext text/x-wiki kzk18yjpiapi371k15w3cjfts21e7ef 8598477 8598475 2026-09-09T23:52:28Z IJuulia 17387949 Created page with "Recrute um administrador do site com permissões de interface. Consulte a página $1 na sua wiki." 8598477 wikitext text/x-wiki akrgq1mvg0jkf738qy5zoq9yxw2ly0w 8598479 8598477 2026-09-09T23:52:40Z IJuulia 17387949 Created page with "Passos para o administrador de interface:" 8598479 wikitext text/x-wiki ciyu69n29zwl4f18nfvj4mi1pq3mdwz 8598481 8598479 2026-09-09T23:53:33Z IJuulia 17387949 Created page with "Copie seus arquivos JS e CSS no [[$2|namespace]] $1 na sua wiki, e certifique-se que os nomes das páginas têm o prefixo $3." 8598481 wikitext text/x-wiki q9p92hrr7ydrpvnof3y8bkrglp80hwq 8598483 8598481 2026-09-09T23:53:38Z IJuulia 17387949 Created page with "''Exemplo:''" 8598483 wikitext text/x-wiki pgxa9qy19l09p9iedp6inr3ypzfo48q 8598485 8598483 2026-09-09T23:53:49Z IJuulia 17387949 Created page with "Defina o ''gadget'' na página $1 da sua wiki." 8598485 wikitext text/x-wiki oe0mgzgx3jr7dp1bfnylyqt0n9lkeq5 8598487 8598485 2026-09-09T23:54:10Z IJuulia 17387949 Created page with "Isso inclui os módulos utilizados, dependências, nomes dos arquivos JS e CSS, etc." 8598487 wikitext text/x-wiki tggygpk3s6zi6m03kpudquym7p6zw1q 8598489 8598487 2026-09-09T23:54:32Z IJuulia 17387949 Created page with "Isso permitirá que usuários ativem o ''gadget'' na sua página $1 da sua wiki." 8598489 wikitext text/x-wiki e6jp4o0hvikp4o263c3h17dgziistwz 8598491 8598489 2026-09-09T23:54:42Z IJuulia 17387949 Created page with "''Exemplo:''" 8598491 wikitext text/x-wiki rep54fiddh8vo554i35x9l5jaojbdsn 8598493 8598491 2026-09-09T23:54:50Z IJuulia 17387949 Created page with "Crie uma página para o ''gadget'' na namespace $1 com o prefixo $2." 8598493 wikitext text/x-wiki bm6u73l8elhbqww1ugfmqgtt4kv8t1h 8598495 8598493 2026-09-09T23:55:03Z IJuulia 17387949 Created page with "Isso gerará uma etiqueta para o ''gadget'' na página $1 de sua wiki." 8598495 wikitext text/x-wiki ingadge8i6v3xvd9271ap1orfq5218g 8598497 8598495 2026-09-09T23:55:07Z IJuulia 17387949 Created page with "''Exemplo:''" 8598497 wikitext text/x-wiki 24v9awe2dnfm7fslpfmf8491e3gjhzq 8598499 8598497 2026-09-09T23:55:20Z IJuulia 17387949 Created page with "== Contribuindo em ''scripts'' de usuário ==" 8598499 wikitext text/x-wiki sysvnso4wmz9ijkqkl5z83penwiascp 8598501 8598499 2026-09-09T23:56:04Z IJuulia 17387949 Created page with "Se um ''script'' de usuário for feito por outro usuário, você deverá ter a possibilidade de contribuir nele." 8598501 wikitext text/x-wiki pdwdhzqovsi9hoqydevew44pfb1rd49 8598503 8598501 2026-09-09T23:56:30Z IJuulia 17387949 Created page with "Você pode fazer isso criando uma cópia do ''script'' de usuário como uma subpágina da sua própria página de usuário." 8598503 wikitext text/x-wiki i9mzz971qil34bqwem74w0448a4vn5r 8598505 8598503 2026-09-09T23:57:03Z IJuulia 17387949 Created page with "Então, substitua o ''script'' de usuário original que você tinha ativo com o que é uma página de usuário em seu $1." 8598505 wikitext text/x-wiki s3xo5iy8ov0kdpbdc74g39rb9bb6mz7 8598507 8598505 2026-09-09T23:57:27Z IJuulia 17387949 Created page with "Prossiga a fazer edições de sua preferência na sua cópia de código do ''script''." 8598507 wikitext text/x-wiki s1prrlafuk8eznf7scewtvrxgcudmji 8598509 8598507 2026-09-09T23:59:17Z IJuulia 17387949 Created page with "Se você quiser que o ''script'' contenha as mudanças que você fez na sua cópia do ''script'', você deveria pingar o autor do ''script'' na página de discussão do ''script'' original com a página que contém suas mudanças e pedir à ele que implemente as mudanças." 8598509 wikitext text/x-wiki e09mg6cgwvuvx0x2haepldx4t96yluj 8598511 8598509 2026-09-09T23:59:57Z IJuulia 17387949 Created page with "Se o usuário não estiver mais ativo, então você deveria notificar a comunidade da sua versão do ''script'' linkando o ''script'' na lista de ''scripts'' da sua wiki." 8598511 wikitext text/x-wiki pf0h5m4gi8tgcclync9nwte1ba3l3jq 8598513 8598511 2026-09-10T00:00:04Z IJuulia 17387949 Created page with "== Páginas relacionadas ==" 8598513 wikitext text/x-wiki 4mccvs5qy52p971j8zronp3aggm6oti 1198 1105399 8598198 3813706 2026-09-09T22:29:30Z IJuulia 17387949 8598198 wikitext text/x-wiki k67y658e0pshh01piz0j8txfmrnigze 1198 1105400 8598200 3813708 2026-09-09T22:30:02Z IJuulia 17387949 8598200 wikitext text/x-wiki 8enc8gc0r7f3eoykkxlub48qxtaqv0w 1198 1105402 8598202 3813711 2026-09-09T22:30:13Z IJuulia 17387949 8598202 wikitext text/x-wiki eojkhfb2vbs9vppwdrjryomlr8ggr7x 8598298 8598202 2026-09-09T22:54:15Z IJuulia 17387949 8598298 wikitext text/x-wiki 7jbkty4526dfm3jqlsbgv7glh5dly1j 1198 1105407 8598212 3813723 2026-09-09T22:36:52Z IJuulia 17387949 8598212 wikitext text/x-wiki 2gcahybyutevzmqk4kn2o474y5ncw22 1198 1105408 8598304 3813725 2026-09-09T22:55:47Z IJuulia 17387949 8598304 wikitext text/x-wiki aawmjtdyl34mfeaeclu4l9qhbffn06u 8598306 8598304 2026-09-09T22:56:04Z IJuulia 17387949 8598306 wikitext text/x-wiki bpinsa2yg1yzvz5q344shw1pxpvb86a 1198 1105411 8598214 3813731 2026-09-09T22:38:39Z IJuulia 17387949 8598214 wikitext text/x-wiki 9ofdoehfm3zb6qva6oco2nbe348nylb 1198 1105412 8598216 3813733 2026-09-09T22:39:52Z IJuulia 17387949 8598216 wikitext text/x-wiki h71wk9cvi18tq42vcx8yh987gels20b 1198 1105413 8598222 3813736 2026-09-09T22:40:56Z IJuulia 17387949 Marked translation unit as no longer outdated with no changes 3813736 wikitext text/x-wiki huz3j4b3ofjmb0hyf9vsr3t9r6owx0g 8598308 8598222 2026-09-09T22:56:45Z IJuulia 17387949 8598308 wikitext text/x-wiki 354w0a599uz8bu7jtlcfxvsk06fpy9g 0 1141221 8597732 8363773 2026-09-09T12:24:00Z FuzzyBot 451990 Updating to match new version of source page 8597732 wikitext text/x-wiki qsoepqf9xr1oxursdoo9x0351mapm48 100 1153192 8598275 8492488 2026-09-09T22:46:06Z FuzzyBot 451990 Updating to match new version of source page 8598275 wikitext text/x-wiki bw7n8wli7w6d85g6qg8zpfvmizjwacj 102 1163658 8597927 8423883 2026-09-09T14:31:02Z ~2026-49020-38 18509700 /* */ 8597927 wikitext text/x-wiki cd6v7u2mdxwg0mr0a4ih60fl4gg2l9e 8597928 8597927 2026-09-09T14:35:04Z Kghbln 189117 Reverted edits by [[Special:Contribs/~2026-49020-38|~2026-49020-38]] ([[User talk:~2026-49020-38|talk]]) to last version by BkHuber 8423883 wikitext text/x-wiki 2gf6gklkt9no263fbson6ikfthzly2f 100 1187944 8597762 8597250 2026-09-09T12:27:30Z FuzzyBot 451990 Updating to match new version of source page 8597762 wikitext text/x-wiki acw3f218o0s66fsw32lthr9qnz9nf5j 0 1249811 8597746 8363788 2026-09-09T12:24:14Z FuzzyBot 451990 Updating to match new version of source page 8597746 wikitext text/x-wiki i87oawa0pqp3860nsxzy5w0v8yeip4y 100 1257173 8598274 8492489 2026-09-09T22:46:06Z FuzzyBot 451990 Updating to match new version of source page 8598274 wikitext text/x-wiki alncuy5k52tyuciqrv9lfqtn6g502el 0 1316098 8597734 8514173 2026-09-09T12:24:01Z FuzzyBot 451990 Updating to match new version of source page 8597734 wikitext text/x-wiki 6ttmwak0g8ejiot79cqzeasdh5rqh16 0 1331453 8597731 8363772 2026-09-09T12:23:59Z FuzzyBot 451990 Updating to match new version of source page 8597731 wikitext text/x-wiki mznsobv84zllxq8s9drxu0xrigbkkf6 0 1331559 8598197 8594761 2026-09-09T22:28:38Z Etonkovidova (WMF) 1850810 8598197 wikitext text/x-wiki jw1xr3gn79caxsgsu7w7fd7mt9prixx 1198 1360262 8597785 4641666 2026-09-09T12:37:32Z SangthaiRester 18507382 8597785 wikitext text/x-wiki 4htszywo8924lvm5bx5p35u1mnenq2q 8597790 8597785 2026-09-09T12:38:33Z Clump 81610 Reverted edits by [[Special:Contribs/SangthaiRester|SangthaiRester]] ([[User talk:SangthaiRester|talk]]) to last version by Chinamoonroll 4641666 wikitext text/x-wiki cgxmv50c28b2dpp3o4boj8i1wkklc6s 0 1360263 8597792 7840405 2026-09-09T12:38:51Z SangthaiRester 18507382 8597792 wikitext text/x-wiki 6c26m7i1epomj9bqfr0sgmld45pkks7 8597794 8597792 2026-09-09T12:39:09Z Clump 81610 Reverted edits by [[Special:Contribs/SangthaiRester|SangthaiRester]] ([[User talk:SangthaiRester|talk]]) to last version by Chinamoonroll 8597794 wikitext text/x-wiki ktp24su0xtdd6xae0ur6leezd7pzpdx 1198 1360265 8597791 4641670 2026-09-09T12:38:50Z SangthaiRester 18507382 8597791 wikitext text/x-wiki ptbgqtewyi3xvukciktg230ab50f5fc 8597793 8597791 2026-09-09T12:39:08Z Clump 81610 Reverted edits by [[Special:Contribs/SangthaiRester|SangthaiRester]] ([[User talk:SangthaiRester|talk]]) to last version by Chinamoonroll 4641670 wikitext text/x-wiki mu0vka7osx0yze9ohbd8tybx3asuilf 100 1385384 8598256 8492471 2026-09-09T22:45:54Z FuzzyBot 451990 Updating to match new version of source page 8598256 wikitext text/x-wiki 7zyepfb5zr4go7egi1ohx7sauff4awn 100 1385407 8598260 8492473 2026-09-09T22:45:56Z FuzzyBot 451990 Updating to match new version of source page 8598260 wikitext text/x-wiki 1wxgs5wh67o3kktkprxyq4vdwoiv09e 0 1427242 8597744 8363785 2026-09-09T12:24:12Z FuzzyBot 451990 Updating to match new version of source page 8597744 wikitext text/x-wiki dkre8dxc408n4jqcm3wq1uejcsmg8mv 0 1476819 8597736 8530432 2026-09-09T12:24:05Z FuzzyBot 451990 Updating to match new version of source page 8597736 wikitext text/x-wiki 9lun29j31we7mn870555mqge8kg38uc 1198 1483479 8598679 5001270 2026-09-10T09:10:46Z FuzzyBot 451990 Importing a new version from external source 8598679 wikitext text/x-wiki 5u7ujf4jdp08bzohcw48ft473w7m8bb 1198 1483482 8598680 8596745 2026-09-10T09:10:46Z FuzzyBot 451990 Importing a new version from external source 8598680 wikitext text/x-wiki jd58jauc0gd4ianh5vck137yjkx2mdl 1198 1483485 8598681 5001276 2026-09-10T09:10:46Z FuzzyBot 451990 Importing a new version from external source 8598681 wikitext text/x-wiki jt5nt1scx0atbfq69usvztvubxrwdcr 1198 1483505 8598682 5001296 2026-09-10T09:10:46Z FuzzyBot 451990 Importing a new version from external source 8598682 wikitext text/x-wiki 913jyakidxfcnrz7svwphs6uskckm26 1198 1483511 8598683 5001302 2026-09-10T09:10:46Z FuzzyBot 451990 Importing a new version from external source 8598683 wikitext text/x-wiki 913jyakidxfcnrz7svwphs6uskckm26 1198 1483525 8598684 5001316 2026-09-10T09:10:47Z FuzzyBot 451990 Importing a new version from external source 8598684 wikitext text/x-wiki 85m58p7rmzgyshueisarya8kadrldja 1198 1483541 8598685 6038806 2026-09-10T09:10:47Z FuzzyBot 451990 Importing a new version from external source 8598685 wikitext text/x-wiki 8a3yl661ykuwc5i2j003ng878s1uq33 1198 1483546 8598686 5001337 2026-09-10T09:10:47Z FuzzyBot 451990 Importing a new version from external source 8598686 wikitext text/x-wiki bhprntjnihin83s3sivqnlz0vh3ctiu 1198 1483549 8598687 5001340 2026-09-10T09:10:47Z FuzzyBot 451990 Importing a new version from external source 8598687 wikitext text/x-wiki no49adn0wn4z97j5nyitooo0vmc0vm7 1198 1483571 8598688 5001362 2026-09-10T09:10:47Z FuzzyBot 451990 Importing a new version from external source 8598688 wikitext text/x-wiki 40uvm4dwp04bjkb5qsln9q919gvrt69 1198 1483595 8598689 5001386 2026-09-10T09:10:48Z FuzzyBot 451990 Importing a new version from external source 8598689 wikitext text/x-wiki 5596k611zjxp17u00x6k2yfeedpqcfr 1198 1483605 8598690 5001396 2026-09-10T09:10:48Z FuzzyBot 451990 Importing a new version from external source 8598690 wikitext text/x-wiki bth8vne8c25jlvk1je8qpo0vlgnhn90 12 1483606 8598696 8596749 2026-09-10T09:10:52Z FuzzyBot 451990 Updating to match new version of source page 8598696 wikitext text/x-wiki hy9y55917wtkk2p0jb09t4xcf1pxftd 12 1483608 8598699 8596754 2026-09-10T09:10:54Z FuzzyBot 451990 Updating to match new version of source page 8598699 wikitext text/x-wiki rklllayfdwrveydprp48bxtct118fqg 12 1483623 8598694 8596750 2026-09-10T09:10:50Z FuzzyBot 451990 Updating to match new version of source page 8598694 wikitext text/x-wiki 463s8ted1r01ljnxn753nbj6m9x1px7 12 1483638 8598697 8596752 2026-09-10T09:10:52Z FuzzyBot 451990 Updating to match new version of source page 8598697 wikitext text/x-wiki b1oh0tsiwmljb9kiarwrliio9vgmbrw 12 1509804 8598695 8596751 2026-09-10T09:10:52Z FuzzyBot 451990 Updating to match new version of source page 8598695 wikitext text/x-wiki 9xk4rtlr44aajun1ciow55kkdrrig09 0 1539978 8597728 8475716 2026-09-09T12:23:55Z FuzzyBot 451990 Updating to match new version of source page 8597728 wikitext text/x-wiki 3ddbkdgg9723h42qanuyxru7gjeddj0 12 1550816 8598692 8596748 2026-09-10T09:10:50Z FuzzyBot 451990 Updating to match new version of source page 8598692 wikitext text/x-wiki e49jqrmurrb7b57sh72mfwkkhdliouc 12 1557223 8598701 8596756 2026-09-10T09:10:55Z FuzzyBot 451990 Updating to match new version of source page 8598701 wikitext text/x-wiki tlhsg8mfjvdzqbc503q5h567kk8oi7q 12 1562346 8597711 8597597 2026-09-09T12:01:36Z Wladek92 887141 Created page with "keymatch est un tableau dont chaque option est soit une chaîne ou un prototype. Dans le cas d'une chaîne une comparaison directe est faite avec la clé du message." 8597711 wikitext text/x-wiki lo661921k3m9nrixfug72prg1jigez8 8597714 8597711 2026-09-09T12:03:51Z Wladek92 887141 Created page with "C'est l'approche utilisée pour vérifier si la clé du message vérifie un motif donné." 8597714 wikitext text/x-wiki d0ydtru6jhuuskrahyv7lwk4u76wo9m 8597716 8597714 2026-09-09T12:17:22Z Wladek92 887141 Created page with "Si vous spécifiez $1 '''en tant que tableau associatif (exemple 2)''', voir ci-dessous pour les détails supplémentaires." 8597716 wikitext text/x-wiki 5fip9dggl31pmur8hnlx1ghg02qaa52 8597718 8597716 2026-09-09T12:22:54Z Wladek92 887141 Created page with "Si vous spécifiez des captures nommées, n'utilisez pas le symbole $1 dans le nom." 8597718 wikitext text/x-wiki jgqkzoqpjbebe4hz58xxe2zcc8z0tv6 8597720 8597718 2026-09-09T12:23:37Z Wladek92 887141 Created page with "Dans l''''example 2''', duex captures nommées sont utilisées - $1 et $2." 8597720 wikitext text/x-wiki tg2mrb8x5wjvgfh30mggxbksw4qs2fc 8597752 8597720 2026-09-09T12:24:33Z Wladek92 887141 Created page with "Les captures nommées préfixées avec $ sont utilisées ici." 8597752 wikitext text/x-wiki 69c3y6ukv9al45c1vkwa5nzs19v9dac 8597754 8597752 2026-09-09T12:25:17Z Wladek92 887141 8597754 wikitext text/x-wiki l6jdvm7lvagxjlo4m2rbcjfm7gys6md 8597765 8597754 2026-09-09T12:27:42Z Wladek92 887141 Created page with "Valeur de pre pour l'élément insérable." 8597765 wikitext text/x-wiki 9zae5cdagbzwxxf9afp3ok5fx1yw5x6 8597767 8597765 2026-09-09T12:28:06Z Wladek92 887141 Created page with "La valeur est insérée ''avant'' la position du curseur." 8597767 wikitext text/x-wiki qbfhigh3bihlpexbk02ys3jpv7roy60 8597770 8597767 2026-09-09T12:28:34Z Wladek92 887141 Created page with "Les captures nommées préfixées avec $1 sont utilisées ici." 8597770 wikitext text/x-wiki 6enwuokltsti7i0h6hgalkpu4jvnb0v 8597772 8597770 2026-09-09T12:29:22Z Wladek92 887141 Created page with "Si elle n'est pas spécifiée, la valeur utilisée est celle de l'affichage." 8597772 wikitext text/x-wiki oepul7nhzvntfiva4qc4f0zw9zqjyuv 8597774 8597772 2026-09-09T12:30:01Z Wladek92 887141 Created page with "La valeur après l'élément insérable." 8597774 wikitext text/x-wiki 05vnwdsunvax90h25q6w20oql0englw 8597776 8597774 2026-09-09T12:30:08Z Wladek92 887141 Created page with "Value insérée après la position du curseur." 8597776 wikitext text/x-wiki tusv54brb0ibuon39owdmoigp2s538f 8597778 8597776 2026-09-09T12:30:39Z Wladek92 887141 8597778 wikitext text/x-wiki 5v1alq2xbpbpbt5exezajv5vsyk3nfq 8597780 8597778 2026-09-09T12:32:40Z Wladek92 887141 8597780 wikitext text/x-wiki kwo7q29zhusr275ffawr9makg6k2yc5 8597782 8597780 2026-09-09T12:33:45Z Wladek92 887141 Created page with "Les captures nommées préfixées par $1 sont utilisées ici." 8597782 wikitext text/x-wiki 92uz9qybjj0w4fdqm7y8ur5uy35ppts 8597784 8597782 2026-09-09T12:34:18Z Wladek92 887141 Created page with "Voici une liste de valideurs embarqués." 8597784 wikitext text/x-wiki er8kuwbm8b582epuv09b9o7aldmy8e3 8597787 8597784 2026-09-09T12:37:47Z Wladek92 887141 Created page with "Veillez à ce que le nombre de parenthèses (ou de crochets) ouvrantes corresponde au nombre de parenthèses (ou de crochets) fermantes dans la traduction." 8597787 wikitext text/x-wiki iyhaewtfxnbzbjgpxke8vwwmz42apce 8597789 8597787 2026-09-09T12:38:22Z Wladek92 887141 Created page with "Par exemple, les traductions suivantes sont acceptées," 8597789 wikitext text/x-wiki 85szn9y5h7f44r0jt7vhfufwpmxf32n 8597796 8597789 2026-09-09T12:39:16Z Wladek92 887141 Created page with "alors que les suivantes sont en faute," 8597796 wikitext text/x-wiki tsjcp8iul0p2mdq8jghgxpz8lfc5vis 8597798 8597796 2026-09-09T12:40:13Z Wladek92 887141 Created page with "Ce valideur ne peut pas être marqué ''élément insérable''." 8597798 wikitext text/x-wiki mnnfnr8tzn2xg8pdbhroy84i5z6d7qi 8597800 8597798 2026-09-09T12:41:19Z Wladek92 887141 Created page with "Le valideur veille à ce que seul les caractères d'échappement spécifiés sont présents dans une traduction." 8597800 wikitext text/x-wiki r0kso70iqbidd4aqu7bdc7lw8e9w55j 8597802 8597800 2026-09-09T12:41:46Z Wladek92 887141 Created page with "Les caractères d'échappement autorisés peuvent être spécifiés lors de l'ajout du valideur et ne peuvent inclure que :" 8597802 wikitext text/x-wiki 5wt2k6kqyvby5f5bk449nvo00dqhzh5 8597804 8597802 2026-09-09T12:42:11Z Wladek92 887141 Created page with "Cela fonctionne spécifiquement pour les groupes de messages basés sur GetText." 8597804 wikitext text/x-wiki jr631pnuw6b1wp0wxbbdhejzrdcsm2b 8597810 8597804 2026-09-09T12:46:39Z Wladek92 887141 Created page with "Cela fonctionne particulièrement avec les groupes de messages basés sur GetText." 8597810 wikitext text/x-wiki oolv3jw5iiojyycvyacfsjrvx90ltbz 8597812 8597810 2026-09-09T12:47:16Z Wladek92 887141 Created page with "Assure que si la source ou la définition contiennent un pluriel dans le format - $1, la traduction doit également le contenir." 8597812 wikitext text/x-wiki 392gjziu9m0cwd7c1tpxxf4krzox9ds 8597814 8597812 2026-09-09T12:47:40Z Wladek92 887141 Created page with "En fonction de la langue, il vérifie également si la traduction a le nombre correct de formes plurielles." 8597814 wikitext text/x-wiki n8picppfa811v5hi14pz2p53zlzagfi 8597816 8597814 2026-09-09T12:47:52Z Wladek92 887141 Created page with "Par exemple, l'anglais en a deux, mais l'hébreu en a quatre." 8597816 wikitext text/x-wiki p4j064b3bbwlt2103abkwigmgstcj38 8597818 8597816 2026-09-09T12:48:28Z Wladek92 887141 Created page with "Un valideur générique réutilisable qui peut être utilisé pour spécifier les validations personnalisées et les éléments insérables." 8597818 wikitext text/x-wiki 3whx3m5i0bdkyw1ueob22knqt6kb362 8597820 8597818 2026-09-09T12:48:58Z Wladek92 887141 Created page with "Par exemple, prenez la configuration suivante où le valideur est marqué comme élément insérable et appliqué," 8597820 wikitext text/x-wiki db8r1do5tktdli8bex4vln2m4rf2010 8597822 8597820 2026-09-09T12:50:13Z Wladek92 887141 Created page with "Compte tenu du message source suivant - $1 qui est en cours de traduction, celle-ci doit avoir les paramètres - $2 et $3." 8597822 wikitext text/x-wiki md7ov2zbtcolzszzlj8dpisnv2xp76i 8597824 8597822 2026-09-09T12:51:21Z Wladek92 887141 Created page with "Ils seront également affichés comme des éléments insérables pour faciliter leur utilisation par les traducteurs dans les traductions." 8597824 wikitext text/x-wiki lgio9jy7x1an5ocqdo7ec0mz1brdndh 8597826 8597824 2026-09-09T12:51:33Z Wladek92 887141 Created page with "L'absence de ces paramètres entraînera l'affichage d'une erreur au traducteur." 8597826 wikitext text/x-wiki 31vxzwoj4tw47ow09o7c6gno7qqaw7r 8597828 8597826 2026-09-09T12:51:56Z Wladek92 887141 Created page with "C'est un validateur qui correspond aux variables ruby dans les traductions." 8597828 wikitext text/x-wiki 13whiota0lu0uukpyot08ls8o0r5jpu 8597830 8597828 2026-09-09T12:52:06Z Wladek92 887141 Created page with "Ce valideur est un élément insérable." 8597830 wikitext text/x-wiki q6vbkchi1ava84owmqw9rkopqulhbwb 8597832 8597830 2026-09-09T12:52:25Z Wladek92 887141 Created page with "Un validateur de variable insérable pour Ios." 8597832 wikitext text/x-wiki os3xywe9ak2vmob9angm2m4pmrpg610 8597834 8597832 2026-09-09T12:52:35Z Wladek92 887141 8597834 wikitext text/x-wiki eot86u1tyea2uugni0hwm01etuyj60g 8597836 8597834 2026-09-09T12:52:42Z Wladek92 887141 Created page with "Ce valideur est un élément insérable." 8597836 wikitext text/x-wiki 7fcavkc8cq8hf4ylwvujv10ygs7jvyi 8597838 8597836 2026-09-09T12:52:52Z Wladek92 887141 Created page with "Veille à ce que la traduction soit présente dans la liste des valeurs." 8597838 wikitext text/x-wiki m0q25j10tgtrzhu0y6ubgsnor5hz79v 8597840 8597838 2026-09-09T12:57:13Z Wladek92 887141 Created page with "Prend également un paramètre - $1 qui peut être soit $2 (''par défault'') ou $3." 8597840 wikitext text/x-wiki 2pfkx9r6vs55uoupw2fi3410poedilu 8597842 8597840 2026-09-09T12:58:59Z Wladek92 887141 Created page with "Vérifie que la traduction a le même nombre de passages à la ligne que le message source au début et à la fin de la chaîne." 8597842 wikitext text/x-wiki 81j5xq3zkw72zm72zg3769uf7zzyfyv 8597844 8597842 2026-09-09T13:00:05Z Wladek92 887141 Created page with "Notez que les valeurs LTR ou RTL ne seront pas valables, puisque $1 vaut $2 par défaut." 8597844 wikitext text/x-wiki kcsox6d97egpmqwxp3215qx2olfvv9s 8597846 8597844 2026-09-09T13:00:44Z Wladek92 887141 Created page with "Vérifie si la traduction utilise des liens non recommandés." 8597846 wikitext text/x-wiki adobaojojzwn4h84u52urhixns6720g 8597848 8597846 2026-09-09T13:01:53Z Wladek92 887141 Created page with "Les liens valides sont ceux qui pointent vers les pages Special:, $1 ou des pages de projet via des messages MediaWiki comme $2." 8597848 wikitext text/x-wiki 53agrwd0nu6uqllunlncc6abtq4zwfv 8597850 8597848 2026-09-09T13:03:28Z Wladek92 887141 Created page with "Veille à ce que si la source ou la définition contiennent un espace de noms tel que $1 les traductions effectuées n'essayent pas de traduire les espaces de noms eux-mêmes." 8597850 wikitext text/x-wiki 04urowwrg0g2dtep32zcovthdf2y157 8597852 8597850 2026-09-09T13:04:35Z Wladek92 887141 Created page with "C'est un valideur qui capte les paramètres du wiki dans les traductions." 8597852 wikitext text/x-wiki mzsta1l8ggdehfougz3xpstbg9q6n4g 8597854 8597852 2026-09-09T13:04:59Z Wladek92 887141 Created page with "Assure que si la source ou définition contiennent un $1, la traduction doit également l'avoir." 8597854 wikitext text/x-wiki id2wsec2bctv5docz3v04r68c22inb0 8597856 8597854 2026-09-09T13:05:39Z Wladek92 887141 Created page with "En fonction de la langue, on vérifie également si la traduction a le nombre correct de formes plurielles." 8597856 wikitext text/x-wiki 5xxkzkh93d3b7j6us3apys97futh67c 8597858 8597856 2026-09-09T13:05:58Z Wladek92 887141 Created page with "Par exemple, l'anglais en a deux, mais l'hébreu en a trois." 8597858 wikitext text/x-wiki 55vhjf828fvtdemrartdhrxx9yeiwwu 8597860 8597858 2026-09-09T13:07:27Z Wladek92 887141 Created page with "Fournit des validations pour les options d'expiration et les options de blocage des adresses IP spécifiées dans le noyau MediaWiki." 8597860 wikitext text/x-wiki o562xdc7hnkqpr87hjbeegfl9t3scta 8597862 8597860 2026-09-09T13:08:12Z Wladek92 887141 Created page with "Ils sont généralement dans le format," 8597862 wikitext text/x-wiki 8l5rqkidid4amcc374x45r17uwtzock 8597864 8597862 2026-09-09T13:08:47Z Wladek92 887141 Created page with "Les validations garantissent que les traductions ont exactement le même nombre de paires clé-valeur." 8597864 wikitext text/x-wiki 6jb5q7snufmbgnur8cer1uinkv3sq97 8597866 8597864 2026-09-09T13:09:18Z Wladek92 887141 Created page with "Ces validations ne sont exécutées que sur les messages avec des clés," 8597866 wikitext text/x-wiki 4ilan6790gmdwf0wu0q32384u2qsbkk 8597868 8597866 2026-09-09T13:09:43Z Wladek92 887141 Created page with "Ce valideur n'est pas un élément insérable." 8597868 wikitext text/x-wiki pb5i754glnsx7lezhet7ge1x2ufqgoh 8597870 8597868 2026-09-09T13:09:52Z Wladek92 887141 Created page with "Ce valideur n'est pas un élément insérable." 8597870 wikitext text/x-wiki fm4ou9qtbgas4ug5fj13xzx8p9kx8gw 8597872 8597870 2026-09-09T13:10:02Z Wladek92 887141 Created page with "Ce valideur est un élément insérable." 8597872 wikitext text/x-wiki toxp2jkf0br7v9j53othc8mfqamx539 8597874 8597872 2026-09-09T13:10:13Z Wladek92 887141 Created page with "Ce valideur est un élément insérable." 8597874 wikitext text/x-wiki g7npqdl5gvzgrooq2yvrd58hn5jay4o 8597876 8597874 2026-09-09T13:10:16Z Wladek92 887141 Created page with "Ce valideur est un élément insérable." 8597876 wikitext text/x-wiki lk9vldrkx1ljdnl26t42j4en9rn9et2 8597878 8597876 2026-09-09T13:10:24Z Wladek92 887141 Created page with "Ce valideur n'est pas un élément insérable." 8597878 wikitext text/x-wiki 0e8bskgudq40vupjig90d11rf0zm8xe 8597880 8597878 2026-09-09T13:11:03Z Wladek92 887141 Created page with "Par exemple, l'anglais en a deux, mais l'hébreu en a quatre." 8597880 wikitext text/x-wiki a1w0jyges83d2sbp0yqvvgi4vfabwkj 8597882 8597880 2026-09-09T13:11:50Z Wladek92 887141 Created page with "Mon Valideur Personnalisé" 8597882 wikitext text/x-wiki nomf00mbc66fo4u4xqf8jxaj4947ceb 8597884 8597882 2026-09-09T13:16:06Z Wladek92 887141 Created page with "Assure que la traduction a un certain contenu, et que ce contenu n'est pas seulement de l'espace blanc." 8597884 wikitext text/x-wiki 0n0b65c8i86vibg3gf4ai27ieo9n6ey 8597887 8597884 2026-09-09T13:19:45Z Wladek92 887141 Created page with "Ce valideur vérifie dans les traductions les caractères manquants et inconnus dans le format du printf." 8597887 wikitext text/x-wiki nms7q6icyzxtmxujx6re841jwxxk7c1 8597889 8597887 2026-09-09T13:20:21Z Wladek92 887141 Created page with "Vérifie si une traduction utilise la chaîne $1 et suggère à la place au traducteur d'utiliser la chaîne mentionnée dans $2." 8597889 wikitext text/x-wiki ikxou7dxnihwv8t9cwsau0bsnqy9z53 8597891 8597889 2026-09-09T13:20:51Z Wladek92 887141 Created page with "Cela fonctionne particulièrement avec les groupes de messages basés sur $1." 8597891 wikitext text/x-wiki nutn13d36b9996e65mu8t8hbbk8p0jl 8597893 8597891 2026-09-09T13:21:24Z Wladek92 887141 Created page with "Par exemple, l'anglais en a deux, mais l'hébreu en a trois." 8597893 wikitext text/x-wiki 0zk56ae8ugssxxoen99s0wj5hczbaiy 8597895 8597893 2026-09-09T13:22:13Z Wladek92 887141 Created page with "L'interface utilisateur a été mise à jour pour faire la différence entre les erreurs et les avertissements." 8597895 wikitext text/x-wiki 4pr5fii22jphtzn1p10m6tkzp8hzk8x 8597897 8597895 2026-09-09T13:22:28Z Wladek92 887141 Created page with "Un avertissement et une erreur affichés en haut d'une traduction" 8597897 wikitext text/x-wiki f3oxgwzio1x8lmnb4tgggtfsuwywuyi 8597901 8597897 2026-09-09T13:39:43Z Wladek92 887141 Created page with "Par exemple dans la configuration suivante, le valideur validera les messages avec la clé - $1 et assurera que ses valeurs sont soit ''ltr'' soit ''rtl''." 8597901 wikitext text/x-wiki qd9s3qz2168kbpuomfzaridkr9dke5x 8597903 8597901 2026-09-09T13:39:52Z Wladek92 887141 8597903 wikitext text/x-wiki 9b4x26tua1px2nqhg056a9upnmmt064 8597905 8597903 2026-09-09T13:42:52Z Wladek92 887141 Created page with "Vérifie que la traduction a le même nombre de passages à la ligne que le source ou le message de définition ''au début de la chaîne''." 8597905 wikitext text/x-wiki jnww4gn1b57r3x4wm98ko4alohtdfrs 8597907 8597905 2026-09-09T13:43:48Z Wladek92 887141 Created page with "Assure que si la source ou la définition contiennent un pluriel dans le format - $1, la traduction doit également le contenir." 8597907 wikitext text/x-wiki jwvx1ygyjlqppy8r9chi6ep6gtiw9cv 8597909 8597907 2026-09-09T13:44:30Z Wladek92 887141 8597909 wikitext text/x-wiki c3yf3its2rtider8gbk5cetmwn0i233 8597911 8597909 2026-09-09T13:45:48Z Wladek92 887141 Created page with "Cela permettra encore aux utilisateurs qui ont les droits $1 de sauvegarder la traduction même si elle contient des erreurs." 8597911 wikitext text/x-wiki tbjb72vanjtqaldrozo9kytl9zh6dzo 8597913 8597911 2026-09-09T13:46:54Z Wladek92 887141 Created page with "Pousser $1 dans $2." 8597913 wikitext text/x-wiki ecny138juo6ntxtsm9obm3zobwiyghy 8597916 8597913 2026-09-09T13:47:48Z Wladek92 887141 Created page with "En outre, la validation est également effectuée sur le serveur lorsque l'utilisateur sauvegarde sa traduction." 8597916 wikitext text/x-wiki tslldvmlvikh0ginjrrf0nuog85tv36 8597919 8597916 2026-09-09T13:48:49Z Wladek92 887141 Created page with "Assure que si le source ou la définition contiennent un pluriel dans le format - $1, la traduction doit également le contenir." 8597919 wikitext text/x-wiki 3hgwo9tpnh892rjbfq2qs1yzoi09slm 8597931 8597919 2026-09-09T14:55:53Z Wladek92 887141 Created page with "En fonction de la langue on vérifie si la traduction a le nombre correct de formes plurielles." 8597931 wikitext text/x-wiki 5uuytyyaxg1xw24uj5f9fqhs076n2hl 8597933 8597931 2026-09-09T14:56:58Z Wladek92 887141 Created page with "En fonction de la langue, on vérifie également si la traduction a le nombre correct de formes plurielles." 8597933 wikitext text/x-wiki gu3qoiezl9ykndt3lvvygrojo70vw7h 8597935 8597933 2026-09-09T14:59:50Z Wladek92 887141 Created page with "Durant la traduction, si une erreur apparaît , le bouton '''Enregistrer la traduction''' est désactivé sauf si l'utilisateur qui traduit a les droits $1." 8597935 wikitext text/x-wiki ajf1s91e45vslzg6xe49yfoyi5drcr5 8598552 8597935 2026-09-10T07:54:30Z Wladek92 887141 8598552 wikitext text/x-wiki l9pu1m927amnglknvxu8682eot3bsok 8598554 8598552 2026-09-10T07:56:01Z Wladek92 887141 8598554 wikitext text/x-wiki d7s5okdzh3oyt9zwzcqx7kve5a8xygu 8598556 8598554 2026-09-10T07:57:07Z Wladek92 887141 8598556 wikitext text/x-wiki 2uhwzr1ot2b3lwok7pd2onei5zgkbqt 8598558 8598556 2026-09-10T07:57:53Z Wladek92 887141 8598558 wikitext text/x-wiki 3ts59wzegmv7tufwvzlrpx0e3dx6b66 8598560 8598558 2026-09-10T07:59:47Z Wladek92 887141 8598560 wikitext text/x-wiki tqjp433yezhofn3fah9z9mxkmv23t6w 8598562 8598560 2026-09-10T08:00:48Z Wladek92 887141 8598562 wikitext text/x-wiki iyvr4ix30xz3o56d9kianzj8cbxskrp 8598564 8598562 2026-09-10T08:02:43Z Wladek92 887141 8598564 wikitext text/x-wiki 5234btq7n5y4zhwi33fr5g1dgkdc0pz 8598566 8598564 2026-09-10T08:03:46Z Wladek92 887141 8598566 wikitext text/x-wiki lhh3c0o64uiwdh56wc2jzd0e8hcu2u7 8598568 8598566 2026-09-10T08:05:03Z Wladek92 887141 8598568 wikitext text/x-wiki 6nvt2rorc044sk3c5iqsj13zhw3ner2 8598570 8598568 2026-09-10T08:05:22Z Wladek92 887141 8598570 wikitext text/x-wiki hzq3k138fx5kgz2gqgljtupij6985cl 8598572 8598570 2026-09-10T08:06:21Z Wladek92 887141 8598572 wikitext text/x-wiki 67j53jk7v9r4n6rauexudl3gy9oifsy 8598574 8598572 2026-09-10T08:08:19Z Wladek92 887141 8598574 wikitext text/x-wiki 63yepe517ctogsjvkckcr36l8yqya1s 8598576 8598574 2026-09-10T08:11:16Z Wladek92 887141 8598576 wikitext text/x-wiki reixtkh2g42fji0y2ugd1i8jbi43xwj 8598578 8598576 2026-09-10T08:12:36Z Wladek92 887141 8598578 wikitext text/x-wiki pm5geanm1al6wtatecj2xh9izdwdza3 8598580 8598578 2026-09-10T08:12:43Z Wladek92 887141 8598580 wikitext text/x-wiki t8yb75kv1ea1l6ocjm07dme4jm0vl14 8598582 8598580 2026-09-10T08:13:13Z Wladek92 887141 8598582 wikitext text/x-wiki taeiocbwmzrj1im5e4dcos13b642efz 8598584 8598582 2026-09-10T08:15:07Z Wladek92 887141 8598584 wikitext text/x-wiki 608mca2vtguwobezmp6dc2lkqen0293 8598586 8598584 2026-09-10T08:16:24Z Wladek92 887141 8598586 wikitext text/x-wiki 94u99voo3if1c56cjruddpvvp5uw8i2 8598588 8598586 2026-09-10T08:17:22Z Wladek92 887141 8598588 wikitext text/x-wiki ox2oby1zedpwnmvsbphg9pnqnjooaj5 8598590 8598588 2026-09-10T08:18:10Z Wladek92 887141 8598590 wikitext text/x-wiki husgrilt2lbwufhv452rbk7qgld7wtf 8598593 8598590 2026-09-10T08:19:04Z Wladek92 887141 8598593 wikitext text/x-wiki rer0extrqe9m3l53x1bj87m6w6ohwvs 8598595 8598593 2026-09-10T08:20:33Z Wladek92 887141 8598595 wikitext text/x-wiki q72ucurwj39aqkt56epf9yk01xtn9bm 8598597 8598595 2026-09-10T08:22:24Z Wladek92 887141 8598597 wikitext text/x-wiki msbxohmw7mxtglhiuwjtemdyjmvs15n 8598599 8598597 2026-09-10T08:23:01Z Wladek92 887141 8598599 wikitext text/x-wiki 8m6wwxhb0jaamuqv7ddfolfmy3ku49a 8598601 8598599 2026-09-10T08:23:50Z Wladek92 887141 8598601 wikitext text/x-wiki t4vnbdkg4pa8qa25fauxyhco01b53xe 8598603 8598601 2026-09-10T08:26:29Z Wladek92 887141 8598603 wikitext text/x-wiki k4ik6k8s611tbt6q6z153w4yh9jplc9 8598605 8598603 2026-09-10T08:27:50Z Wladek92 887141 8598605 wikitext text/x-wiki mit5bx490ub75xo5vmr4bbj0kr3qi5c 8598607 8598605 2026-09-10T08:30:14Z Wladek92 887141 8598607 wikitext text/x-wiki if6er8uqc1hedmsqjoqe3vaszsaqxyu 8598609 8598607 2026-09-10T08:31:11Z Wladek92 887141 8598609 wikitext text/x-wiki eaga3bdhm72zmyd2t4ktw2n5zhpoqsc 8598611 8598609 2026-09-10T08:39:07Z Wladek92 887141 8598611 wikitext text/x-wiki 64lbz39ncpceqhajgg3e24yw48bpcbm 8598614 8598611 2026-09-10T08:40:56Z Wladek92 887141 8598614 wikitext text/x-wiki tuf20kgrn6ln8sksrpd5cejg75erz9c 8598616 8598614 2026-09-10T08:41:38Z Wladek92 887141 8598616 wikitext text/x-wiki djocmok8vlledpzjdd3abpnref5sd2r 8598618 8598616 2026-09-10T08:42:01Z Wladek92 887141 8598618 wikitext text/x-wiki bcwm6iplfn767b0695vwlwdnvh0iq4t 8598621 8598618 2026-09-10T08:44:15Z Wladek92 887141 8598621 wikitext text/x-wiki 6u3djr8acudg23emrlp7yshtnmwihqu 8598623 8598621 2026-09-10T08:45:01Z Wladek92 887141 8598623 wikitext text/x-wiki 23otk2r6v7jv8ch3vjmg07wiq1cagc5 8598625 8598623 2026-09-10T08:46:20Z Wladek92 887141 8598625 wikitext text/x-wiki pvd72fuoa921hy1muva3076lhgj8b9f 8598627 8598625 2026-09-10T08:50:32Z Wladek92 887141 8598627 wikitext text/x-wiki pr1qcc6zr4tfapnb6p9zi4up613wd2i 8598629 8598627 2026-09-10T08:51:50Z Wladek92 887141 8598629 wikitext text/x-wiki bjo60uh0bdef0a958twqsdzbrxprvyt 8598631 8598629 2026-09-10T08:52:14Z Wladek92 887141 8598631 wikitext text/x-wiki 17nmvhuskrbh9z0tueyffzzwr6pf549 8598633 8598631 2026-09-10T08:53:51Z Wladek92 887141 8598633 wikitext text/x-wiki qrr5abjrh8p4avsvbsvtbhmc7wqvgiw 8598635 8598633 2026-09-10T08:55:06Z Wladek92 887141 8598635 wikitext text/x-wiki f61zosy32k1y224yr1jy050l1esid7k 8598698 8598635 2026-09-10T09:10:53Z FuzzyBot 451990 Updating to match new version of source page 8598698 wikitext text/x-wiki kxfz44382hvtmatyz66zkwpji76d29d 8598709 8598698 2026-09-10T09:11:19Z Wladek92 887141 8598709 wikitext text/x-wiki 6ek8tzn0tn3u0y8zv0k3c7sowies8j6 8598713 8598709 2026-09-10T09:12:27Z Wladek92 887141 8598713 wikitext text/x-wiki dpqtfrap9n42fxkciwo13h0whypfdp7 8598717 8598713 2026-09-10T09:12:49Z Wladek92 887141 8598717 wikitext text/x-wiki jfgyfwcsns3gy03sk6g45qrchav59j4 8598721 8598717 2026-09-10T09:13:02Z Wladek92 887141 8598721 wikitext text/x-wiki dtqszfoqldd6qbu0ppmzl1qh25mvuv5 8598723 8598721 2026-09-10T09:13:08Z Wladek92 887141 8598723 wikitext text/x-wiki 85qqrvbce7ozq3lih10a5bbbm6jgy1a 8598727 8598723 2026-09-10T09:13:18Z Wladek92 887141 8598727 wikitext text/x-wiki aube9uo8prm3vumz7h6s90oog8a6z5m 8598729 8598727 2026-09-10T09:13:50Z Wladek92 887141 8598729 wikitext text/x-wiki c51n4hsi0awaad4xrtddtnryycj9sqf 8598735 8598729 2026-09-10T09:14:15Z Wladek92 887141 8598735 wikitext text/x-wiki 2ususik77wk6l456gms91h0uoesrj6h 8598739 8598735 2026-09-10T09:14:39Z Wladek92 887141 8598739 wikitext text/x-wiki p1mzsnyggcf0bbjz0qmw75up80voy5v 8598751 8598739 2026-09-10T09:17:18Z Wladek92 887141 8598751 wikitext text/x-wiki 0wltoyn1pgay4342zmgve0wbg02dr6k 8598767 8598751 2026-09-10T09:18:03Z Wladek92 887141 8598767 wikitext text/x-wiki c3mafooocbrza2kdjmyyt8x6pqkb9n9 8598769 8598767 2026-09-10T09:18:30Z Wladek92 887141 8598769 wikitext text/x-wiki q2fq2evjvkpz46eo3ujcgq2ra19p1e8 0 1575444 8597739 8364080 2026-09-09T12:24:08Z FuzzyBot 451990 Updating to match new version of source page 8597739 wikitext text/x-wiki 5j6b0d62wdurdkxi6jlu73k9ls0fmlf 8598638 8597739 2026-09-10T09:00:05Z HanV 6324917 8598638 wikitext text/x-wiki syiawea5a3kilqg8li45giod3mxflwz 8598641 8598638 2026-09-10T09:00:59Z HanV 6324917 8598641 wikitext text/x-wiki sajzgpc2p9zti5wyugwjq4a7pfvgm0x 4 1595022 8598527 8587783 2026-09-10T04:50:07Z Alexis Jazz 932007 Updating gadget usage statistics from [[Special:GadgetUsage]] ([[phab:T121049]]) 8598527 wikitext text/x-wiki crs8py92haqstflmt8y30xtu4cdvtal 1198 1601004 8598353 5369208 2026-09-09T23:15:52Z IJuulia 17387949 8598353 wikitext text/x-wiki srjxbyve9er8wrxy73q8vz4sarzi2v5 1198 1601100 8598347 5369307 2026-09-09T23:12:37Z IJuulia 17387949 8598347 wikitext text/x-wiki 9ukdfamceab93epz0nhhwpk3x17b2j3 1198 1601753 8598345 5370035 2026-09-09T23:12:29Z IJuulia 17387949 8598345 wikitext text/x-wiki echio31kja77stq8q049hmm9w3gge4k 1198 1601768 8598336 5370060 2026-09-09T23:07:46Z IJuulia 17387949 8598336 wikitext text/x-wiki e7cwpuiayoy77ukfkotcjw96karoi5w 100 1632391 8598269 8492483 2026-09-09T22:46:02Z FuzzyBot 451990 Updating to match new version of source page 8598269 wikitext text/x-wiki aw2dofra30vwdcgrqo0emteah10gg52 0 1651866 8597733 8363774 2026-09-09T12:24:01Z FuzzyBot 451990 Updating to match new version of source page 8597733 wikitext text/x-wiki hv3mnjt8facn3bd70i05yu09jt3lzso 0 1728755 8597748 8455696 2026-09-09T12:24:16Z FuzzyBot 451990 Updating to match new version of source page 8597748 wikitext text/x-wiki khknj391x0u8d37r1x7pwwcu4araq38 12 1820106 8598703 8596757 2026-09-10T09:10:56Z FuzzyBot 451990 Updating to match new version of source page 8598703 wikitext text/x-wiki l6ntj87s102fmrmruvbu3cmzd465qqm 100 1834378 8598273 8492485 2026-09-09T22:46:05Z FuzzyBot 451990 Updating to match new version of source page 8598273 wikitext text/x-wiki a2m2g6jne9uh6jv41sw8ynilylnfsl3 100 1852930 8597806 8319885 2026-09-09T12:43:48Z ~2026-48805-41 18509654 Instagram password 8597806 wikitext text/x-wiki 0p3mi27hr55bjpjxrpz35e5p254xv54 8597899 8597806 2026-09-09T13:24:38Z Divinations 18009523 Reverted edits by [[Special:Contribs/~2026-48805-41|~2026-48805-41]] ([[User talk:~2026-48805-41|talk]]) to last version by Saurmandal 8597899 wikitext text/x-wiki 9enbx7h2c3mkzlpao9d13q355mokzq6 1198 1852942 8597805 8319861 2026-09-09T12:43:47Z ~2026-48805-41 18509654 Instagram password 8597805 wikitext text/x-wiki ppcseb3ynny3h9b0jf2g3gtn9jyobp0 8597898 8597805 2026-09-09T13:24:37Z Divinations 18009523 Reverted edits by [[Special:Contribs/~2026-48805-41|~2026-48805-41]] ([[User talk:~2026-48805-41|talk]]) to last version by Saurmandal 8319861 wikitext text/x-wiki pl5ky2brokofb42so7s73zvnfdu0uvs 0 1864059 8597735 8363776 2026-09-09T12:24:03Z FuzzyBot 451990 Updating to match new version of source page 8597735 wikitext text/x-wiki op8ac9l8sj30mlelzrocg6ubhfo101v 1 1867461 8597768 8596682 2026-09-09T12:28:16Z Yodin 235492 /* Section only links breaking for some templates */ Reply 8597768 wikitext text/x-wiki gddycwajbhappfbctzoedg4w5xol461 8597926 8597768 2026-09-09T14:30:38Z Ahecht 1468257 /* Section only links breaking for some templates */ Reply 8597926 wikitext text/x-wiki 48vvd99spgb3mmdclbcqvjwqh034fwo 8597939 8597926 2026-09-09T15:41:05Z ABreault (WMF) 1746190 /* Section only links breaking for some templates */ Reply 8597939 wikitext text/x-wiki gw0ww8vupts29e20kdovs4ctztuc6oe 8598550 8597939 2026-09-10T07:52:54Z Yodin 235492 /* Section only links breaking for some templates */ Reply 8598550 wikitext text/x-wiki taf09arnxnka8gufglva4jwshg3bche 8598646 8598550 2026-09-10T09:02:04Z Yodin 235492 /* Section only links breaking for some templates */ fix punctuation in my last comment 8598646 wikitext text/x-wiki rqx0onro3si6pvf0j0p5tahf10lhb2w 8598661 8598646 2026-09-10T09:04:56Z Yodin 235492 /* Section only links breaking for some templates */ adding question about how many other templates and modules that will be affected 8598661 wikitext text/x-wiki pyvddkkyywl6ml89sxib5g10brol5of 8598676 8598661 2026-09-10T09:10:18Z Yodin 235492 /* Section only links breaking for some templates */ fixing link 8598676 wikitext text/x-wiki hissa8ft0ehkawlrnx7echri7qtbx2t 1198 1872738 8597721 6214451 2026-09-09T12:23:42Z FuzzyBot 451990 Importing a new version from external source 8597721 wikitext text/x-wiki d9b27pbr4yhx9wnv2kkk5p09yt72lck 1198 1872739 8597722 6214452 2026-09-09T12:23:42Z FuzzyBot 451990 Importing a new version from external source 8597722 wikitext text/x-wiki 8ffmnfizo9c65rlzre06gk1xgtlr6oe 0 1873367 8597727 8363770 2026-09-09T12:23:55Z FuzzyBot 451990 Updating to match new version of source page 8597727 wikitext text/x-wiki sfcm8uzel8apww31kuleqd3n4y8kwte 1 1886172 8598118 8555904 2026-09-09T21:03:56Z ~2026-49084-88 18509906 /* Wikidata Project chat titles */ new section 8598118 wikitext text/x-wiki imnu501f6g2jozo4fp0s2rinvn3hww5 8598917 8598118 2026-09-10T11:58:05Z SCP-2000 16904824 /* Wikidata Project chat titles */ reply 8598917 wikitext text/x-wiki i94yzpdoepl30j2q3hh4sk9rorbxh88 12 1890821 8598700 8596755 2026-09-10T09:10:54Z FuzzyBot 451990 Updating to match new version of source page 8598700 wikitext text/x-wiki 31mszok9rcdy3c94bwp0wsca80alton 1198 1893121 8598637 6293626 2026-09-10T09:00:05Z HanV 6324917 8598637 wikitext text/x-wiki lzh2nij7sbn0jgz8eycj6rkioak28ct 1198 1893122 8598640 6293628 2026-09-10T09:00:59Z HanV 6324917 8598640 wikitext text/x-wiki jzv7hcj5oysyxtsocg1qwip3hgrrwkm 3 1896299 8598775 8595086 2026-09-10T09:20:40Z ArchiverBot 1174107 Bot: Archiving 2 threads (older than 30 days) to [[User talk:Nvdtn19/Archive 2026 8]] 8598775 wikitext text/x-wiki 4t7ppkoh2elrebalkr1khjjg6fi6a83 4 1932178 8598520 7059635 2026-09-10T01:01:24Z Youssef nabil nageb 18510002 8598520 wikitext text/x-wiki ayp109tuir32npjaet3yr6kyic3t2rr 8598522 8598520 2026-09-10T01:02:00Z Youssef nabil nageb 18510002 8598522 wikitext text/x-wiki f62bu9b8pem5mran87s7qq1hzdoqpc6 8598813 8598522 2026-09-10T10:50:32Z Clump 81610 Reverted edits by [[Special:Contribs/Youssef nabil nageb|Youssef nabil nageb]] ([[User talk:Youssef nabil nageb|talk]]) to last version by Renamed user 851b26d2b880a794c9e1e4d005ea7b50 8598813 wikitext text/x-wiki in9kw15l27rph99jpq9ex5gpg1cshzx 8598815 8598813 2026-09-10T10:50:37Z Clump 81610 Reverted edits by [[Special:Contribs/Youssef nabil nageb|Youssef nabil nageb]] ([[User talk:Youssef nabil nageb|talk]]) to last version by Renamed user 851b26d2b880a794c9e1e4d005ea7b50 8598815 wikitext text/x-wiki ccrvr0okuasth0nrxni5uzz491j7psi 1198 1932931 8598519 6427671 2026-09-10T01:01:23Z Youssef nabil nageb 18510002 8598519 wikitext text/x-wiki 7hhhgwdc9tblbrsh1xzo7ohmkxr2tn5 8598812 8598519 2026-09-10T10:50:31Z Clump 81610 Reverted edits by [[Special:Contribs/Youssef nabil nageb|Youssef nabil nageb]] ([[User talk:Youssef nabil nageb|talk]]) to last version by Renamed user 851b26d2b880a794c9e1e4d005ea7b50 6427671 wikitext text/x-wiki tirk34xwp778cwvmsc3chuwpzqpi1h6 1198 1932933 8598521 6427675 2026-09-10T01:02:00Z Youssef nabil nageb 18510002 8598521 wikitext text/x-wiki 858prbnyvsnnxxt5ioivvvrf4ges10b 8598814 8598521 2026-09-10T10:50:36Z Clump 81610 Reverted edits by [[Special:Contribs/Youssef nabil nageb|Youssef nabil nageb]] ([[User talk:Youssef nabil nageb|talk]]) to last version by Renamed user 851b26d2b880a794c9e1e4d005ea7b50 6427675 wikitext text/x-wiki jqpi3qge6kpbxr83ijt6kjbkrwozxjx 0 1952841 8598535 8596100 2026-09-10T05:40:49Z ~2026-48863-71 18510120 Removed redirect to [[MediaWiki user conferences]] 8598535 wikitext text/x-wiki tidw5u18x47oxmy3fqznr2kfpcd29s2 8598536 8598535 2026-09-10T05:45:26Z Divinations 18009523 Reverted edits by [[Special:Contribs/~2026-48863-71|~2026-48863-71]] ([[User talk:~2026-48863-71|talk]]) to last version by Clump 7674647 wikitext text/x-wiki 342ctqd151hcke0sku8o07yctmkekeq 1198 1974172 8598119 8253746 2026-09-09T21:13:06Z TheBigOveis 18509913 8598119 wikitext text/x-wiki 41qhxlxis4japjfgn7o2zddp8mj6jao 8598122 8598119 2026-09-09T21:15:14Z Clump 81610 Reverted edits by [[Special:Contribs/TheBigOveis|TheBigOveis]] ([[User talk:TheBigOveis|talk]]) to last version by Clump 6556731 wikitext text/x-wiki a4nlj27b4a28ltlsulchsgah4ytvte1 0 1994575 8598128 8597022 2026-09-09T21:19:30Z Thibaulltt 18509916 /* Bregman divergence dark mode error */ new section 8598128 wikitext text/x-wiki 8w2f3f4sl39ezk1dgnklbel2ddtq2l0 0 2004675 8597922 8596320 2026-09-09T14:12:52Z Jdforrester (WMF) 574543 Chores done. 8597922 wikitext text/x-wiki p7bx0klvmf7p1etpg3e565jtzm5q0id 0 2008007 8598117 8596094 2026-09-09T21:02:19Z Udo T. 1698873 Please report any future issues with dark mode in the German-language Wiktionary (de.wiktionary.org) at [[:de:wikt:Wiktionary:Dunkelmodus/Probleme|Wiktionary:Dunkelmodus/Probleme]] 8598117 wikitext text/x-wiki bff13wmmu5ux832bxdzqq2w2iv6htsw 0 2040469 8598136 8326201 2026-09-09T22:07:38Z IJuulia 17387949 Created page with "MediaWiki oferece as seguintes APIs web:" 8598136 wikitext text/x-wiki dmpuwo8wbf3p1vbnj98pkfwu3ht9p3j 8598138 8598136 2026-09-09T22:08:06Z IJuulia 17387949 8598138 wikitext text/x-wiki 3kh5pysxdh650miiw8u3j8xjehqhwg1 8598140 8598138 2026-09-09T22:08:28Z IJuulia 17387949 Created page with "a [[$1|API de REST do MediaWiki]]" 8598140 wikitext text/x-wiki 8bwiqtlak9wuxvi0iil6d6lb2fluoei 8598142 8598140 2026-09-09T22:09:31Z IJuulia 17387949 Created page with "A API de Ação disponibiliza uma gama muito maior de funcionalidades, enquanto a API de REST (que é mais nova) tem URLs melhor estruturadas e executa mais rapidamente." 8598142 wikitext text/x-wiki 4v0y5fqlaf4ccmb9dsrjdx6dmy2yxcr 8598144 8598142 2026-09-09T22:09:57Z IJuulia 17387949 Created page with "O MediaWiki também oferece as seguintes APIs de software:" 8598144 wikitext text/x-wiki f8tkjq8uhgheygz0klqaobmmk9i5rpt 8598146 8598144 2026-09-09T22:10:21Z IJuulia 17387949 8598146 wikitext text/x-wiki fnclu3tcniy8zls9ey5nbvwi79ymdkp 8598148 8598146 2026-09-09T22:11:08Z IJuulia 17387949 8598148 wikitext text/x-wiki o8xif7s3bydmtrzopvnunztbr1mz6co 8598150 8598148 2026-09-09T22:11:44Z IJuulia 17387949 8598150 wikitext text/x-wiki saa0fxgcvs8e0e8zf1s3rm6xf2orp0h 8598152 8598150 2026-09-09T22:12:20Z IJuulia 17387949 8598152 wikitext text/x-wiki 3xwbn5o4d6ot7920h9wfhclw39qyf3y 8598154 8598152 2026-09-09T22:13:29Z IJuulia 17387949 Created page with "Dentro do contexto do website do MediaWiki, a API de ação pode ser acessada por JavaScript através do API de JavaScript $2." 8598154 wikitext text/x-wiki 2kyf1krynwe2ax8e6ftfqf1mh37h1bb 8598156 8598154 2026-09-09T22:14:32Z IJuulia 17387949 Created page with "($1 para requisições entre-sites permitidas, por exemplo, entre wikis WMF.)" 8598156 wikitext text/x-wiki kumdvyxcy5j5pqxdacmf9pvr9ug2t39 8598158 8598156 2026-09-09T22:15:07Z IJuulia 17387949 Created page with "== APIs para wikis da Wikimedia ==" 8598158 wikitext text/x-wiki l5rf1m5a7axf39w3hu7sn0jmu2xt83y 8598160 8598158 2026-09-09T22:15:22Z IJuulia 17387949 Created page with "Para informações sobre APIs disponíveis para wikis da Wikimedia, consulte $1." 8598160 wikitext text/x-wiki 6jw2bb1d6inozlhfqffngpbp8htfu7j 8598162 8598160 2026-09-09T22:15:30Z IJuulia 17387949 8598162 wikitext text/x-wiki k11ldm6q4iwn4ll5hw2a7lbs4n2g1ch 8598164 8598162 2026-09-09T22:16:03Z IJuulia 17387949 8598164 wikitext text/x-wiki rttn5uu8j6x9irgz4pkf5t8mms67vj5 8598166 8598164 2026-09-09T22:16:48Z IJuulia 17387949 8598166 wikitext text/x-wiki glkrhknrqw5puvogjgbx44k5ow91w81 8598168 8598166 2026-09-09T22:17:06Z IJuulia 17387949 8598168 wikitext text/x-wiki 2fovi18orkj7bufd65rvc50u5y7u7kh 8598170 8598168 2026-09-09T22:17:26Z IJuulia 17387949 8598170 wikitext text/x-wiki 9l5h2ur1tam3a5mjbej3m3hg0xej4a6 8598172 8598170 2026-09-09T22:17:54Z IJuulia 17387949 8598172 wikitext text/x-wiki 2fovi18orkj7bufd65rvc50u5y7u7kh 8598174 8598172 2026-09-09T22:18:21Z IJuulia 17387949 8598174 wikitext text/x-wiki 28z0qtamf7ev5l28ovm9u4e4qtd1nxl 8598176 8598174 2026-09-09T22:18:30Z IJuulia 17387949 8598176 wikitext text/x-wiki 2aapg5hikg4izpvaeu1e21edej7nrco 8598178 8598176 2026-09-09T22:18:46Z IJuulia 17387949 8598178 wikitext text/x-wiki 6qcnf9pbnbwhqimfbjvlqyyfmr5vikl 8598180 8598178 2026-09-09T22:18:57Z IJuulia 17387949 8598180 wikitext text/x-wiki gm6dgjqbmcimx9jt8czjucrdydc8vm3 8598182 8598180 2026-09-09T22:19:05Z IJuulia 17387949 8598182 wikitext text/x-wiki 6krg0xtiuomhha5yoqyo1j6lg8xfgg4 8598184 8598182 2026-09-09T22:20:02Z IJuulia 17387949 8598184 wikitext text/x-wiki 6c90ye264ak3kxm4ahm4gbslgpp1b3m 8598186 8598184 2026-09-09T22:20:08Z IJuulia 17387949 8598186 wikitext text/x-wiki cp08ctaqhaelahrm3bae9x52seycahz 8598188 8598186 2026-09-09T22:21:07Z IJuulia 17387949 8598188 wikitext text/x-wiki ngcvwm7u5s66xtuhi7p3p16shsarsiz 8598190 8598188 2026-09-09T22:21:23Z IJuulia 17387949 8598190 wikitext text/x-wiki ezvtbfjg6fg9aacs8jp1ljiyz3i40rc 8598192 8598190 2026-09-09T22:21:43Z IJuulia 17387949 8598192 wikitext text/x-wiki dume3upr7cylepxu7753boxadgojcv6 8598194 8598192 2026-09-09T22:22:03Z IJuulia 17387949 8598194 wikitext text/x-wiki 5n2c5xl13ofkp82r6isp9o8m1ajkbf9 8598196 8598194 2026-09-09T22:26:35Z IJuulia 17387949 8598196 wikitext text/x-wiki 8nycg8whs0e9s5x7mls4ec2m3fqq8b2 1198 2040507 8598165 6792484 2026-09-09T22:16:47Z IJuulia 17387949 8598165 wikitext text/x-wiki bpenp5w4b9exh0atvg0czuu4056lfmj 8598167 8598165 2026-09-09T22:17:06Z IJuulia 17387949 8598167 wikitext text/x-wiki ej1lf1plmlb2k7je3ekqupm7hk4hn0w 8598195 8598167 2026-09-09T22:26:34Z IJuulia 17387949 8598195 wikitext text/x-wiki q282u916sppoo4iirra1colkvyx4iyj 1198 2040509 8598137 6792488 2026-09-09T22:08:06Z IJuulia 17387949 8598137 wikitext text/x-wiki oegsxip8kxivyqldloute711bdahlgg 1198 2040510 8598145 6792490 2026-09-09T22:10:21Z IJuulia 17387949 8598145 wikitext text/x-wiki qvphhfpt09h6bzoyh5oq4cs8sn74cn7 1198 2040512 8598149 6792494 2026-09-09T22:11:44Z IJuulia 17387949 8598149 wikitext text/x-wiki l4lboiifr1rjuj5i6nx38mrzqxddcfi 1198 2040520 8598163 6792510 2026-09-09T22:16:02Z IJuulia 17387949 8598163 wikitext text/x-wiki iq67lvb0603gofkii2p386ll4wm4r04 1198 2040522 8598161 6792514 2026-09-09T22:15:29Z IJuulia 17387949 8598161 wikitext text/x-wiki m7ebv024niytb0z3tj1cixm9fqzk3fo 1198 2040523 8598151 6792517 2026-09-09T22:12:20Z IJuulia 17387949 8598151 wikitext text/x-wiki 0adljnwz9wj4zal70c4o3fgpyzqswbv 1198 2040524 8598147 6792519 2026-09-09T22:11:07Z IJuulia 17387949 8598147 wikitext text/x-wiki cs67rh78h6g61nj4u0tuloceiaroof0 4 2084484 8598777 8597026 2026-09-10T09:21:00Z ArchiverBot 1174107 Bot: Archiving 1 thread (older than 14 days) to [[Project:Support desk/Archive 26]] 8598777 wikitext text/x-wiki 9uxw2k2uoeml3q6cg7ujmwmfhmqv7mu 1 2086555 8597952 8589252 2026-09-09T17:40:53Z Doc James 40815 /* CBC.ca */ 8597952 wikitext text/x-wiki bezbksjo70a70gu9ximgkgq3rjiob59 8597953 8597952 2026-09-09T17:41:34Z Doc James 40815 /* CBC.ca */ 8597953 wikitext text/x-wiki 6yi9w8y74oz6gn09b9w9ntdcauy1al7 101 2090611 8598107 8307849 2026-09-09T19:54:26Z Daimona Eaytoy 6722846 /* Type declarations for legacy classes */ new section 8598107 wikitext text/x-wiki onoaw5q3og2zutdmzsa72fmpj1um3tf 100 2107205 8598268 8492482 2026-09-09T22:46:01Z FuzzyBot 451990 Updating to match new version of source page 8598268 wikitext text/x-wiki 9e5hv9671ppoqzyskpw3p2025a2k4n6 3 2131491 8598344 8263965 2026-09-09T23:12:18Z ~2026-48908-53 18509962 8598344 wikitext text/x-wiki ea792c8j4q91lw9gdp0tgpvxds9vknl 8598515 8598344 2026-09-10T00:37:52Z SCP-2000 16904824 Reverted edits by [[Special:Contribs/~2026-48908-53|~2026-48908-53]] ([[User talk:~2026-48908-53|talk]]) to last version by UOzurumba (WMF) 8263965 wikitext text/x-wiki qlgn3m4hhgbb98ywxbf0qs7a0crlnla 3 2150965 8598781 8595085 2026-09-10T09:21:20Z ArchiverBot 1174107 Bot: Archiving 1 thread (older than 30 days) to [[User talk:Serhio Magpie/Archive 2026]] 8598781 wikitext text/x-wiki 5cy9kcecuor7caye40n7qly4o0tyi17 1198 2160538 8598794 7486526 2026-09-10T09:32:31Z AromaTake 2087904 8598794 wikitext text/x-wiki erpw4rj2219xytpvdei2lygt22zf6eb 100 2197147 8598798 8267803 2026-09-10T10:00:14Z ~2026-49050-79 18510274 Created page with "l" 8598798 wikitext text/x-wiki rlj97afo3ftnux9htmlalfxsj9hvgap 8598804 8598798 2026-09-10T10:37:40Z Veritas Sapientiae 17658810 Not a translation (via [[:metawikimedia:User:NDKDD/QT|QuickTranslation]]) 8598804 wikitext text/x-wiki lz97q7lwkw47m7knumsg79m44sl7jrj 2 2203063 8597948 8595820 2026-09-09T17:16:41Z Serhio Magpie 1775170 [8d22b7a] [v6.8.0+build.2]: Updated from repository. 8597948 javascript text/javascript c41umq2fn9outbq7s67aali1aootot1 2 2203064 8597947 8595819 2026-09-09T17:16:38Z Serhio Magpie 1775170 [8d22b7a] [v6.8.0+build.2]: Updated from repository. 8597947 css text/css 6uqpioglegl525r4hxsi66yoqbmdng3 2 2203101 8597950 8595821 2026-09-09T17:19:15Z Serhio Magpie 1775170 [8d22b7a] [v6.8.0]: Updated from repository. 8597950 javascript text/javascript b9et1xpjc833lur5zrcew3lk7fh5nka 2 2203103 8597949 8595817 2026-09-09T17:19:13Z Serhio Magpie 1775170 [8d22b7a] [v6.8.0]: Updated from repository. 8597949 css text/css hszurb7yuoznjsy53xyoi054hy0gwa6 100 2223492 8598262 8492476 2026-09-09T22:45:57Z FuzzyBot 451990 Updating to match new version of source page 8598262 wikitext text/x-wiki nccknf79lroa839t71onvnpf2q07sox 0 2234135 8597937 8597697 2026-09-09T15:16:40Z Tommyoldschool1972 18509730 /* enwiki:User:DonnieNova */ new section 8597937 wikitext text/x-wiki t7uqbmqbo3wio4liil1jagb9etynxgr 8597938 8597937 2026-09-09T15:18:30Z NDG 17947414 Reverted edits by [[Special:Contribs/Tommyoldschool1972|Tommyoldschool1972]] ([[User talk:Tommyoldschool1972|talk]]) to last version by Clump 8597182 wikitext text/x-wiki m65ndeungbva5xmqm5jry8wt0abu3rz 8597951 8597938 2026-09-09T17:21:53Z Beny007000 18509781 /* dewiki:IPhone 18 Pro */ new section 8597951 wikitext text/x-wiki 9j4y5luwggzjv71xrujwekc1jq5dstj 8597988 8597951 2026-09-09T18:23:42Z Clump 81610 Reverted edits by [[Special:Contribs/Beny007000|Beny007000]] ([[User talk:Beny007000|talk]]) to last version by NDG 8597182 wikitext text/x-wiki m65ndeungbva5xmqm5jry8wt0abu3rz 8598129 8597988 2026-09-09T21:30:58Z Нейроманьяк 18229115 /* ruwiki:Убийство Анастасии Гришман */ new section 8598129 wikitext text/x-wiki 9kxhipgq492lfdqpw33uj4waombzsrz 8598130 8598129 2026-09-09T21:39:56Z ~2026-49102-77 18509927 new section 8598130 wikitext text/x-wiki 4li5eiczius97qaxm2g8hh9x1wywae2 8598548 8598130 2026-09-10T07:40:32Z ~2026-49027-92 18510189 . 8598548 wikitext text/x-wiki d8qbn1afd4dsda3rt6a62mp6zmucgqq 8598549 8598548 2026-09-10T07:41:45Z Saroj 9047672 Reverted edits by [[Special:Contribs/~2026-49027-92|~2026-49027-92]] ([[User talk:~2026-49027-92|talk]]) to last version by ~2026-49102-77 8598130 wikitext text/x-wiki 4li5eiczius97qaxm2g8hh9x1wywae2 8598796 8598549 2026-09-10T09:57:42Z Ddolls 18510272 /* enwiki:Help:Preferences */ new section 8598796 wikitext text/x-wiki 5rgf9k1o5iaa5go17dyxz7ki3vg6ajn 8598811 8598796 2026-09-10T10:49:56Z Clump 81610 remove off-topic 8598811 wikitext text/x-wiki 9kxhipgq492lfdqpw33uj4waombzsrz 0 2235781 8597941 8295484 2026-09-09T16:00:03Z ARamadan-WMF 17637702 Adding Expriment 3 8597941 wikitext text/x-wiki j8ii3nv1cokvuojddl5sko8v8wyj1o1 8597942 8597941 2026-09-09T16:02:28Z ARamadan-WMF 17637702 /* Experiment set-up */ 8597942 wikitext text/x-wiki dzf6m7v9zyv0ixosrb67fyb9h2s6yvj 0 2237501 8598255 8145893 2026-09-09T22:45:44Z FuzzyBot 451990 Updating to match new version of source page 8598255 wikitext text/x-wiki t77cy03a9bkvb94xkmbbp4gfy633g4u 828 2238776 8598526 8596990 2026-09-10T04:22:31Z Bawolff bot 13724180 Resyncing with extension.json from git 8598526 json application/json a2c62479k7xxwh9c6d9kvqiwjje6t1n 828 2238876 8598799 8422122 2026-09-10T10:24:06Z Bawolff bot 13724180 Resyncing with extension.json from git 8598799 json application/json 9z4754479rqqr105dyicxdjb6cgx86n 828 2239016 8597925 8591076 2026-09-09T14:30:09Z Bawolff bot 13724180 Resyncing with extension.json from git 8597925 json application/json ret5qg7lhpcax2epwt8t4wtilknc1kr 828 2239093 8598108 8596991 2026-09-09T20:26:22Z Bawolff bot 13724180 Resyncing with extension.json from git 8598108 json application/json muuk0anicvw5epcle69vh604qzmbx4k 828 2239119 8598109 8543617 2026-09-09T20:26:38Z Bawolff bot 13724180 Resyncing with extension.json from git 8598109 json application/json 53dum38k1ol6jz8aaa0uu45cnyrudwe 828 2239193 8598110 8596992 2026-09-09T20:27:15Z Bawolff bot 13724180 Resyncing with extension.json from git 8598110 json application/json ejm5b79udhclfcjikomfdnrf5n5rdjd 828 2239283 8598800 8422286 2026-09-10T10:28:02Z Bawolff bot 13724180 Resyncing with extension.json from git 8598800 json application/json bwxqcatshgyvsd0xudmlp37z5sizgpe 828 2239343 8598111 8452048 2026-09-09T20:28:45Z Bawolff bot 13724180 Resyncing with extension.json from git 8598111 json application/json 2zs6dqjgmuz7812rswabyghha767ho8 828 2239520 8598112 8590221 2026-09-09T20:30:27Z Bawolff bot 13724180 Resyncing with extension.json from git 8598112 json application/json m81w75vpo2fjwpn8cr0pget6y0pqccz 828 2239531 8598113 7781681 2026-09-09T20:30:33Z Bawolff bot 13724180 Resyncing with extension.json from git 8598113 json application/json sk9je6afql8i5m32hv65j3vcr6ale1p 828 2239683 8598115 8422433 2026-09-09T20:32:00Z Bawolff bot 13724180 Resyncing with extension.json from git 8598115 json application/json dfp4n8dge7ufwcnxmw6p6natc1whdix 0 2243420 8598254 8145892 2026-09-09T22:45:44Z FuzzyBot 451990 Updating to match new version of source page 8598254 wikitext text/x-wiki sh9onwa1g413i8yhchvzadanznxq6xi 0 2247388 8598253 8145891 2026-09-09T22:45:44Z FuzzyBot 451990 Updating to match new version of source page 8598253 wikitext text/x-wiki fuwbqmjiydg5n8j4m24ut088qnoz4r4 0 2251598 8598248 8525712 2026-09-09T22:45:30Z FuzzyBot 451990 Updating to match new version of source page 8598248 wikitext text/x-wiki tvp1vq6ch6s1zxfllhu28y7ci9fvyz1 0 2252862 8598250 8525714 2026-09-09T22:45:30Z FuzzyBot 451990 Updating to match new version of source page 8598250 wikitext text/x-wiki fptrverbounmq93i9lx28n1v1ox65p2 1 2266023 8598022 8591888 2026-09-09T19:32:12Z Rusalkii 13929886 /* Adds edit summaries */ new section 8598022 wikitext text/x-wiki gfv1qg6qqk7qqs6f3vhj9zlb094bvhf 8598023 8598022 2026-09-09T19:34:08Z Rusalkii 13929886 /* Adds edit summaries */ clarify home wiki 8598023 wikitext text/x-wiki gzlvteo1gnfl76ds5u1qns9bg84spn1 8598534 8598023 2026-09-10T05:26:11Z NguoiDungKhongDinhDanh 17473507 /* Edit summaries */ Reply 8598534 wikitext text/x-wiki 844sse9avhyquyws0qjmlld9jyvr8kp 102 2266327 8598019 8566194 2026-09-09T19:13:39Z MusikAnimal (WMF) 6437010 note that CommunityConfiguration is required 8598019 wikitext text/x-wiki qdhkc9zunjawoktsngwizktli8ev4i5 0 2284195 8598753 8570881 2026-09-10T09:17:29Z Yushu-kasai 17795004 Translated into ja 8598753 wikitext text/x-wiki fdll5imbraibdae36b5tfiehp5rzt8y 8598755 8598753 2026-09-10T09:17:31Z Yushu-kasai 17795004 Translated into ja 8598755 wikitext text/x-wiki r9rd846artrrjahm5v8stbd8azc0pho 8598757 8598755 2026-09-10T09:17:33Z Yushu-kasai 17795004 Translated into ja 8598757 wikitext text/x-wiki 92rh93xi56vbwd6erndsfwmrl7lpnbp 8598759 8598757 2026-09-10T09:17:35Z Yushu-kasai 17795004 Translated into ja 8598759 wikitext text/x-wiki 2t1jpc2sl9ygd9dmfs5qkddss7umo7c 8598761 8598759 2026-09-10T09:17:40Z Yushu-kasai 17795004 Translated into ja 8598761 wikitext text/x-wiki couslbhnqy7a8u573mmmbyasjjdneh3 8598763 8598761 2026-09-10T09:17:43Z Yushu-kasai 17795004 Translated into ja 8598763 wikitext text/x-wiki lkxyh3mmhmkxvqsmu6uvucp7dn28zt5 8598765 8598763 2026-09-10T09:17:44Z Yushu-kasai 17795004 Translated into ja 8598765 wikitext text/x-wiki 118wsuzvrhm34bcc7ta4wdbxrap9hh4 8598791 8598765 2026-09-10T09:23:56Z Yushu-kasai 17795004 Proofread 8598791 wikitext text/x-wiki rgwivbq14zveufwye07hlgol8uf2far 0 2310327 8598132 8563595 2026-09-09T22:05:14Z ~2026-48946-86 18509936 Created page with "Install $1" 8598132 wikitext text/x-wiki hf5xveebup5mgakx7e916ds20rvyqep 8598134 8598132 2026-09-09T22:05:26Z ~2026-48946-86 18509936 Created page with "Set $1" 8598134 wikitext text/x-wiki 1uhjotga1mjvs26wo40ovvsu0tv5sx4 8598816 8598134 2026-09-10T10:51:47Z Clump 81610 Not a translation 8598816 wikitext text/x-wiki hf5xveebup5mgakx7e916ds20rvyqep 8598817 8598816 2026-09-10T10:51:54Z Clump 81610 Not a translation 8598817 wikitext text/x-wiki k57v6e51asf7sfb9ca2ygs2upyg02ly 102 2314482 8597914 8595745 2026-09-09T13:47:30Z Thomas-topway-it 17152865 8597914 wikitext text/x-wiki kh5tdp4v1kg2ax437zop9lcoj3g1dql 8597917 8597914 2026-09-09T13:48:05Z Thomas-topway-it 17152865 8597917 wikitext text/x-wiki tkl9cluwq68fprdwjsscica73i7qjsw 8597920 8597917 2026-09-09T13:52:51Z Thomas-topway-it 17152865 8597920 wikitext text/x-wiki ormxvzoh9zimao4jyghz6hisuxlwi2o 8597921 8597920 2026-09-09T13:53:46Z Thomas-topway-it 17152865 8597921 wikitext text/x-wiki eqcmtjpssf4gt9ebnncw69sx5sblaxk 8597923 8597921 2026-09-09T14:23:21Z Thomas-topway-it 17152865 8597923 wikitext text/x-wiki m0ypfs15gj8cdt53ydbqwyefbrb8x0n 8597924 8597923 2026-09-09T14:24:21Z Thomas-topway-it 17152865 8597924 wikitext text/x-wiki slwqx0kvp6wgybfmx0cd66f4l77cqsd 1 2315368 8598523 8596953 2026-09-10T03:32:14Z UOzurumba (WMF) 17424318 /* Reference checks */ Reply 8598523 wikitext text/x-wiki saeueu92b9xtbhpcvn0iu73q7z4o528 8598524 8598523 2026-09-10T03:35:50Z UOzurumba (WMF) 17424318 Moved outline requests to Vikipedi tartışma:MaddeYönergesi for experienced editors visibility. 8598524 wikitext text/x-wiki ebnvruzechfa1gsbtxrt01mdepopmj0 0 2327335 8598251 8546273 2026-09-09T22:45:32Z FuzzyBot 451990 Updating to match new version of source page 8598251 wikitext text/x-wiki nqqydcmakl9rvswn22n5oqz8pj7cn1d 0 2352147 8598252 8525716 2026-09-09T22:45:33Z FuzzyBot 451990 Updating to match new version of source page 8598252 wikitext text/x-wiki kt40wq91w95jijeq6825enavhp7h0to 0 2359567 8597723 8363764 2026-09-09T12:23:50Z FuzzyBot 451990 Updating to match new version of source page 8597723 wikitext text/x-wiki 0nroso5kzrbeoqa0bce4tmvoglhcf4o 0 2381422 8598533 8596986 2026-09-10T05:05:32Z VWalters-WMF 17613640 Update browser test listing (automated) 8598533 wikitext text/x-wiki as1b353iqe0wlm9h2eg26qog8d5l0c8 0 2382316 8597737 8363778 2026-09-09T12:24:05Z FuzzyBot 451990 Updating to match new version of source page 8597737 wikitext text/x-wiki clamuh845nvywyrd86acp2f3h4yskvu 3 2386452 8598780 8588066 2026-09-10T09:21:10Z ArchiverBot 1174107 Bot: Archiving 1 thread from [[User talk:Serhio Magpie]] 8598780 wikitext text/x-wiki 5jlb6d9r2rpadc1uhbvys1k2zsueh5j 0 2391480 8598883 8525720 2026-09-10T11:41:29Z Dyolf77 (WMF) 17171605 8598883 wikitext text/x-wiki swln1h93mhuyf6a6ebxbpz6ros6agux 8598885 8598883 2026-09-10T11:41:36Z Dyolf77 (WMF) 17171605 Created page with "== الترميزات في المخططات ==" 8598885 wikitext text/x-wiki 4sou4knl79cy3bcoi0raduft8i82pne 8598887 8598885 2026-09-10T11:42:03Z Dyolf77 (WMF) 17171605 8598887 wikitext text/x-wiki sro28nykcstqmj5o8dkrulhvr3xwnbz 8598889 8598887 2026-09-10T11:42:13Z Dyolf77 (WMF) 17171605 Created page with "تستخدم ميزة إرشاد المقالات هذه المخططات في مراحل مختلفة من إنشاء المقالة الجديدة." 8598889 wikitext text/x-wiki n0xbninok9w6lq871z80lde2ivbzm6r 8598891 8598889 2026-09-10T11:42:23Z Dyolf77 (WMF) 17171605 Created page with "يمكن تكييف المخططات من مخططات موجودة،" 8598891 wikitext text/x-wiki dcnoh05k5npxylucu94e98969j9q4zs 8598893 8598891 2026-09-10T11:42:31Z Dyolf77 (WMF) 17171605 Created page with "مثل تلك الموجودة على [$1 هذه الصفحة]." 8598893 wikitext text/x-wiki dviv1fw3crfbnpmuaxzf5kt21l8fujo 8598895 8598893 2026-09-10T11:42:41Z Dyolf77 (WMF) 17171605 Created page with "يمكن أيضًا إنشاؤها من الصفر باستخدام الترميزات المطلوبة كما هو موضح في مخطط موجود." 8598895 wikitext text/x-wiki demow202lvsqyze23bkw924yyqu4agz 8598897 8598895 2026-09-10T11:43:11Z Dyolf77 (WMF) 17171605 8598897 wikitext text/x-wiki duuo3e5zyx6wh9d6arpyj2fvqrbes7e 8598899 8598897 2026-09-10T11:43:23Z Dyolf77 (WMF) 17171605 8598899 wikitext text/x-wiki j9a9jms57mbio0jldfkglb7kg03h06d 8598901 8598899 2026-09-10T11:43:38Z Dyolf77 (WMF) 17171605 8598901 wikitext text/x-wiki 93krdc3igbt7uox87yd3ma9i0b08oyl 8598904 8598901 2026-09-10T11:43:47Z Dyolf77 (WMF) 17171605 Created page with "علامة" 8598904 wikitext text/x-wiki 6afionh385h4pe8b84u679no9lxutym 8598906 8598904 2026-09-10T11:43:59Z Dyolf77 (WMF) 17171605 Created page with "تشير إلى الاسم الذي سيُستخدم عند عرض المخطط." 8598906 wikitext text/x-wiki i3q29ssvhg3fbnurwrdq2qyivwbu5de 8598908 8598906 2026-09-10T11:44:08Z Dyolf77 (WMF) 17171605 Created page with "افتراضيًا، تُسمّى المخططات مثل عنصر ويكي بيانات المرتبط بها." 8598908 wikitext text/x-wiki p28rgqyrzns5fg5sruy2e8evzza6n9u 8598910 8598908 2026-09-10T11:44:40Z Dyolf77 (WMF) 17171605 Created page with "تتيح خاصية «العلامة» للمجتمعات تحديد اسم مختلف أكثر توافقًا مع ممارساتها." 8598910 wikitext text/x-wiki 7io2thc31qvcbcitp387chn11ki3swa 8598912 8598910 2026-09-10T11:45:13Z Dyolf77 (WMF) 17171605 Created page with "على سبيل المثال، يمكن لمخطط عنصر ويكي بيانات Q5 («إنسان») استخدام خاصية «العلامة» ليُعرض باسم «سيرة» بدلاً من ذلك." 8598912 wikitext text/x-wiki p60qvxe6woiqrwfcgh6dslbtxxpovc7 8598914 8598912 2026-09-10T11:45:36Z Dyolf77 (WMF) 17171605 8598914 wikitext text/x-wiki 5bsnj7jyv6220w7xoy8po75m2ixhyk9 8598916 8598914 2026-09-10T11:45:56Z Dyolf77 (WMF) 17171605 Created page with "في هذه الحالة، $1 + $2 + $3 يشير إلى أنه لا يمكن إنشاء هذه المقالة إلا إذا كانت موجودة في ويكي بيانات، وإذا كانت موجودة في 5 ويكيات أخرى بلغات أخرى، وأن هذين القيدين ينطبقان فقط على المحررين المبتدئين، وليس المحررين المتمرسين." 8598916 wikitext text/x-wiki trz8iio0ium0wvfj5q3glszxf950lxg 1198 2391486 8598882 8371657 2026-09-10T11:41:28Z Dyolf77 (WMF) 17171605 8598882 wikitext text/x-wiki ifk42od4vo5s15wg6p06v0e16upmc91 0 2398088 8598532 8596985 2026-09-10T05:05:30Z VWalters-WMF 17613640 Update browser test listing JSON (automated) 8598532 json application/json syqxcl130is98y1n93vx4hem2alzv4j 12 2402721 8598702 8596758 2026-09-10T09:10:55Z FuzzyBot 451990 Updating to match new version of source page 8598702 wikitext text/x-wiki f92m0vq73h065h23zmhjcqx3myecru2 1198 2404391 8598913 8371642 2026-09-10T11:45:36Z Dyolf77 (WMF) 17171605 8598913 wikitext text/x-wiki px4v6tsmgkmyivx4b8u85vm49xbn034 0 2406453 8597885 8596647 2026-09-09T13:16:59Z SWangari-WMF 17989246 8597885 wikitext text/x-wiki oyuuxr74js8eztp7fwq9qjm5btj2e7v 100 2412373 8597760 8597248 2026-09-09T12:27:28Z FuzzyBot 451990 Updating to match new version of source page 8597760 wikitext text/x-wiki ko4lj6ln07ixyruajxm447a7fygp0bv 1198 2421683 8598886 8424616 2026-09-10T11:42:02Z Dyolf77 (WMF) 17171605 8598886 wikitext text/x-wiki 3c70p4bxh16v96axz1rognqjjm49v08 100 2425293 8598265 8492479 2026-09-09T22:45:59Z FuzzyBot 451990 Updating to match new version of source page 8598265 wikitext text/x-wiki lcfhvegwi779t4v8qnx17dc1y2ifu12 828 2440334 8598114 8594851 2026-09-09T20:31:55Z Bawolff bot 13724180 Resyncing with extension.json from git 8598114 json application/json 9zxcpzwj97muaebi102t9i6mueiqwtq 0 2440987 8598249 8525713 2026-09-09T22:45:30Z FuzzyBot 451990 Updating to match new version of source page 8598249 wikitext text/x-wiki phsdevvd07ikdwlk90g0e4kct7538k2 0 2444289 8597940 8521304 2026-09-09T15:51:41Z ~2026-48827-90 18509743 8597940 wikitext text/x-wiki kcv2mw1vguaqje93d9u5ujgqeerq3ml 4 2448915 8598776 8597025 2026-09-10T09:20:50Z ArchiverBot 1174107 Bot: Archiving 1 thread from [[Project:Support desk]] 8598776 wikitext text/x-wiki c07pa858zol0xkceumyayroqrm2z60j 1 2460327 8598375 8566919 2026-09-09T23:23:27Z Rusalkii 13929886 /* Thread on this at enwiki */ new section 8598375 wikitext text/x-wiki 1ki6jz0dcz9p5t8eesis7ox9xs206c0 0 2465270 8598869 8597013 2026-09-10T11:34:33Z Dyolf77 (WMF) 17171605 8598869 wikitext text/x-wiki b67rt0y4q8jii96x1i7sa5q7i9j6svk 8598871 8598869 2026-09-10T11:35:58Z Dyolf77 (WMF) 17171605 8598871 wikitext text/x-wiki 2qjjsajqtvcb17ssfhd09bhoi3mv27b 8598873 8598871 2026-09-10T11:36:11Z Dyolf77 (WMF) 17171605 8598873 wikitext text/x-wiki sjcb5sku6j9efm5t47r3skk8ahrzrlr 8598875 8598873 2026-09-10T11:36:24Z Dyolf77 (WMF) 17171605 8598875 wikitext text/x-wiki j8c5z2wk4q2k689gyksoovilxplbeoa 8598877 8598875 2026-09-10T11:36:34Z Dyolf77 (WMF) 17171605 8598877 wikitext text/x-wiki bqcpl3drjlvuetwnizwqv5mdzzszayn 8598879 8598877 2026-09-10T11:36:52Z Dyolf77 (WMF) 17171605 8598879 wikitext text/x-wiki 8f0yjtxf1hot7z4wbgpn1tvgk5sr7hp 8598881 8598879 2026-09-10T11:37:03Z Dyolf77 (WMF) 17171605 8598881 wikitext text/x-wiki cnv8sk7agt2epvav9h8cwwkmi7aiou3 0 2468605 8598643 8597531 2026-09-10T09:01:38Z HanV 6324917 Created page with "Een app voor Android-devices om foto's te uploaden naar [[$1|Wikimedia Commons]]" 8598643 wikitext text/x-wiki 5a5breug316p5ri18luq11f7ucihq7n 8598645 8598643 2026-09-10T09:01:44Z HanV 6324917 Created page with "[$dash Wiki Education Dashboard]" 8598645 wikitext text/x-wiki 392ayc7ah0jk8wg64ld1iqh2544efvf 8598648 8598645 2026-09-10T09:02:07Z HanV 6324917 Created page with "Een webapplicatie die Wikipedia-onderwijsopdrachten ondersteunt, het biedt gegevens en cursusbeheer voor docenten en studenten" 8598648 wikitext text/x-wiki 2qj6i098dj7m7pysrt4xuf4oq87hce0 8598650 8598648 2026-09-10T09:02:33Z HanV 6324917 Created page with "Een 'Python'-bibliotheek en een verzameling scripts die werk automatiseren op MediaWiki-sites." 8598650 wikitext text/x-wiki phl6mjlkrr98z5edqjl8zuadha1jaqd 8598652 8598650 2026-09-10T09:02:36Z HanV 6324917 Created page with "Mentor(en):" 8598652 wikitext text/x-wiki 17o6y2pvi7fk5iaz0d6hdfwwp706dfl 8598654 8598652 2026-09-10T09:02:42Z HanV 6324917 Created page with "Schrijver" 8598654 wikitext text/x-wiki kiaicxk5yg4tn41fcuk2rfmyywqvwmc 8598656 8598654 2026-09-10T09:03:16Z HanV 6324917 8598656 wikitext text/x-wiki kwajv75zntz4gv2ecoff8sxb9d60uvc 8598658 8598656 2026-09-10T09:04:26Z HanV 6324917 Created page with "[$1 Scribe] biedt Wikidata-gebaseerde toetsenborden voor leerlingen van een tweede taal. De functies zijn onder meer vertaling, werkwoordsvervoeging en zelfstandig naamwoord-geslacht annotatie. Dit project is zeer open voor iedereen die de benodigde talen wil leren en hoe hij met Wikidata kan werken!" 8598658 wikitext text/x-wiki l760mfqshocn4u9h4s5apjhd7jo2gdm 8598660 8598658 2026-09-10T09:04:49Z HanV 6324917 Created page with "Vereiste vaardigheden: [$1 Swift] voor [$2 Scribe-iOS]; [$3 Kotlin] voor [$4 Scribe-Android]; [$5 Python] en/of [$6 Wikidata Query Service] voor onze [$7 Scribe-Data taal data-extractie CLI]" 8598660 wikitext text/x-wiki qdbm399bx52na10omx2s4iblzep658j 8598663 8598660 2026-09-10T09:05:00Z HanV 6324917 Created page with "Mentor: [[$1|Andrew McAllister]]" 8598663 wikitext text/x-wiki 84oddr5yp5rheumrf5k9rc03mvkedn0 8598665 8598663 2026-09-10T09:05:02Z HanV 6324917 Created page with "Mentor(en):" 8598665 wikitext text/x-wiki gcibms0ay64sxyow3in45w0aobl0cxs 8598667 8598665 2026-09-10T09:05:41Z HanV 6324917 Created page with "De webbrowser-extensie Lingua Libre SignIt vertaalt geselecteerd geschreven woord via een elegante pop-up zodat u gebarentaal leert terwijl u online leest." 8598667 wikitext text/x-wiki batfkd940zh9fa0kk0qt5p16d6or02p 8598669 8598667 2026-09-10T09:06:32Z HanV 6324917 Created page with "U kunt een ondertekende video toevoegen met $1 door een taal te selecteren en vervolgens zelf een video op te nemen tijdens het ondertekenen." 8598669 wikitext text/x-wiki l18ces2eiwx5vsln321um9aqjap7stx 8598671 8598669 2026-09-10T09:06:35Z HanV 6324917 Created page with "Mentor(en):" 8598671 wikitext text/x-wiki 93i3toeb9rgtwadzcmjnvdwp8b7qsuk 8598673 8598671 2026-09-10T09:08:34Z HanV 6324917 8598673 wikitext text/x-wiki d57l2mgh0zxvi55tqemjo8g75pw5d1a 8598675 8598673 2026-09-10T09:09:26Z HanV 6324917 Created page with "''Bent u een maintainer en wilt u dat uw project in de bovenstaande lijst van softwareprojecten wordt opgenomen? [[$1|Lees meer!]]''" 8598675 wikitext text/x-wiki rhoumcw085wz3mjzjihwrg5b55vr4d4 8598693 8598675 2026-09-10T09:10:50Z HanV 6324917 Created page with "== Outreach-programma's en losse taken ==" 8598693 wikitext text/x-wiki myhg8zic55p9z49kiszsk1jcgwsbu5y 8598705 8598693 2026-09-10T09:10:59Z HanV 6324917 Created page with "Naast de bovenstaande aanbevolen softwareprojecten zijn er meer manieren om een project of taak te kiezen om aan te werken:" 8598705 wikitext text/x-wiki n5m2y8gdlkmbd4msbca0nnrngrjl0w5 8598707 8598705 2026-09-10T09:11:07Z HanV 6324917 Created page with "[[$1|Outreach programma's]]" 8598707 wikitext text/x-wiki qw3l9dbcxham4jsavb75ko7eqtfzg58 8598711 8598707 2026-09-10T09:11:43Z HanV 6324917 Created page with "Wikimedia biedt stages aan in programma's zoals "Google Summer of Code" en "Outreachy"." 8598711 wikitext text/x-wiki 3gmdomwejqbstwghawsegmwxvix6xp0 1 2469051 8597943 8587915 2026-09-09T16:07:44Z Trizek (WMF) 2360649 /* Retex utilisateur */ Reply 8597943 wikitext text/x-wiki r8a9mswg5n7hktcf3q4es8bppwaho2n 3 2469104 8598774 8588056 2026-09-10T09:20:30Z ArchiverBot 1174107 Bot: Archiving 2 threads from [[User talk:Nvdtn19]] 8598774 wikitext text/x-wiki ttfu337kam5oer72rmmmq1w3hifef3k 102 2469205 8597808 8590671 2026-09-09T12:44:18Z Wlft 18301417 8597808 wikitext text/x-wiki mm2xid8ns8wl4mdhvbcl5ps8s1e9u81 102 2469206 8597807 8590670 2026-09-09T12:44:03Z Wlft 18301417 8597807 wikitext text/x-wiki kpivyop1a21my08qx2j6cms4tzghg45 1198 2471779 8598868 8595974 2026-09-10T11:34:32Z Dyolf77 (WMF) 17171605 8598868 wikitext text/x-wiki qeiaau7o09shg52z8mtkowzmo4x60hr 1198 2471780 8598870 8595976 2026-09-10T11:35:57Z Dyolf77 (WMF) 17171605 8598870 wikitext text/x-wiki 713qkkandf6knitkaoc0rcfxohv32d9 1198 2471781 8598872 8595978 2026-09-10T11:36:11Z Dyolf77 (WMF) 17171605 8598872 wikitext text/x-wiki puygzsxzrzwqeiofuzjv7n8klrec86y 1198 2471782 8598874 8595980 2026-09-10T11:36:23Z Dyolf77 (WMF) 17171605 8598874 wikitext text/x-wiki tkdzin6410hxsdqmwyj1mo08en8vba9 1198 2471784 8598876 8595984 2026-09-10T11:36:34Z Dyolf77 (WMF) 17171605 8598876 wikitext text/x-wiki 8bgxxezsu9ga1azqmhvrciy6c8r5qik 1198 2471785 8598878 8595986 2026-09-10T11:36:52Z Dyolf77 (WMF) 17171605 8598878 wikitext text/x-wiki 9w6owd69sq267wt7cizj3xrso53utee 1198 2471787 8598880 8595990 2026-09-10T11:37:02Z Dyolf77 (WMF) 17171605 8598880 wikitext text/x-wiki ellpfgu18qreehg9svtkuenv6o64zwx 1198 2471876 8598768 8596300 2026-09-10T09:18:29Z Wladek92 887141 8598768 wikitext text/x-wiki ilh1u8frdr6us7mrt4cvyy3dxuz4olk 1198 2471882 8598630 8596311 2026-09-10T08:52:14Z Wladek92 887141 8598630 wikitext text/x-wiki ong4dbugclqde1tvyfd670urtc3nb5y 8598766 8598630 2026-09-10T09:18:02Z Wladek92 887141 8598766 wikitext text/x-wiki qmth81zr7rrdatox4tjjehnb70zlc7p 1198 2471883 8598628 8596313 2026-09-10T08:51:49Z Wladek92 887141 8598628 wikitext text/x-wiki t76ampyfoxsvucc9sy41b29verzgr7f 1198 2471886 8598563 8596321 2026-09-10T08:02:42Z Wladek92 887141 8598563 wikitext text/x-wiki auf9gjvc79p9kvxzsygh7kom09gfsb4 1198 2471891 8598565 8596332 2026-09-10T08:03:45Z Wladek92 887141 8598565 wikitext text/x-wiki 4kjra4qi2j6exprbvgqvu8xoo721sr3 8598569 8598565 2026-09-10T08:05:21Z Wladek92 887141 8598569 wikitext text/x-wiki ooguv9knc0auxpku4z07z3j627e9ok2 8598712 8598569 2026-09-10T09:12:26Z Wladek92 887141 8598712 wikitext text/x-wiki bhe4ye5fektxrwd4gemyrgp8a8k8cy2 1198 2471899 8598551 8596354 2026-09-10T07:54:29Z Wladek92 887141 8598551 wikitext text/x-wiki 0zkj72curm6v17s00pzlx5z1kc2ijy9 1198 2471901 8598553 8596358 2026-09-10T07:56:00Z Wladek92 887141 8598553 wikitext text/x-wiki ojvmabdj3uq47wjlw1vm4w0136i1pp3 1198 2471904 8598555 8596364 2026-09-10T07:57:06Z Wladek92 887141 8598555 wikitext text/x-wiki 8bmtj3zr4h8o2kp88bkwzjcmvj4may0 8598557 8598555 2026-09-10T07:57:52Z Wladek92 887141 8598557 wikitext text/x-wiki 6rbdsmjc279mbnjeb7z0gnn64jyvtex 1198 2471925 8598559 8596406 2026-09-10T07:59:46Z Wladek92 887141 8598559 wikitext text/x-wiki 8wgkb09u91txqb2zkbbcsk0zyvba30h 1198 2471950 8598602 8596477 2026-09-10T08:26:28Z Wladek92 887141 8598602 wikitext text/x-wiki 6ov8gg9hjkwswgi7uslw73wwctpf5rp 8598728 8598602 2026-09-10T09:13:49Z Wladek92 887141 8598728 wikitext text/x-wiki 09qaqcm7asm7ti76mr9k4otexdov4sg 1198 2471969 8598561 8596535 2026-09-10T08:00:47Z Wladek92 887141 8598561 wikitext text/x-wiki f1hi9tosgdi6dvauwu2c1m3ua4zwl2n 1198 2471970 8598632 8596543 2026-09-10T08:53:51Z Wladek92 887141 8598632 wikitext text/x-wiki sp7m5md2fgbods1qsqqqt7ntylrc0xm 1198 2471977 8598567 8596561 2026-09-10T08:05:02Z Wladek92 887141 8598567 wikitext text/x-wiki 8woxk2e89dyj568zwtalfcnycfiymk6 8598716 8598567 2026-09-10T09:12:48Z Wladek92 887141 8598716 wikitext text/x-wiki lbxjobkyo3p5ayx73rngtfq0a7wdznr 1198 2471978 8598606 8596563 2026-09-10T08:30:12Z Wladek92 887141 8598606 wikitext text/x-wiki jb8glbu0qsefga5wf1hr0j9im0na6qh 1198 2472284 8598571 8597582 2026-09-10T08:06:20Z Wladek92 887141 8598571 wikitext text/x-wiki l8ck6vy0tax7glxwbnz17xt15nuee8o 1198 2472345 8597710 2026-09-09T12:01:35Z Wladek92 887141 Created page with "keymatch est un tableau dont chaque option est soit une chaîne ou un prototype. Dans le cas d'une chaîne une comparaison directe est faite avec la clé du message." 8597710 wikitext text/x-wiki 1t835inf7jz5yfgn2pvmjdg1bl1kqo4 8598708 8597710 2026-09-10T09:11:19Z Wladek92 887141 8598708 wikitext text/x-wiki 23p4iukv5vbksg9vl8cyjarghuhsrlz 1198 2472346 8597713 2026-09-09T12:03:50Z Wladek92 887141 Created page with "C'est l'approche utilisée pour vérifier si la clé du message vérifie un motif donné." 8597713 wikitext text/x-wiki gqkj32ld5jft05a1gwf43didtwejyit 1198 2472347 8597715 2026-09-09T12:17:21Z Wladek92 887141 Created page with "Si vous spécifiez $1 '''en tant que tableau associatif (exemple 2)''', voir ci-dessous pour les détails supplémentaires." 8597715 wikitext text/x-wiki 1iuixpijytht5g5t5l6le8nt1itafs9 8598573 8597715 2026-09-10T08:08:18Z Wladek92 887141 8598573 wikitext text/x-wiki 8mgl456d1ztzwybo8ycihu3elvou903 1198 2472348 8597717 2026-09-09T12:22:53Z Wladek92 887141 Created page with "Si vous spécifiez des captures nommées, n'utilisez pas le symbole $1 dans le nom." 8597717 wikitext text/x-wiki 8jokws1q45jsw888h564nrzkmrc0bjc 1198 2472349 8597719 2026-09-09T12:23:36Z Wladek92 887141 Created page with "Dans l''''example 2''', duex captures nommées sont utilisées - $1 et $2." 8597719 wikitext text/x-wiki szjd0tjrejmamdc7vsjwfe8j3t9nf6h 8597753 8597719 2026-09-09T12:25:16Z Wladek92 887141 8597753 wikitext text/x-wiki 4dijvsr4zngz643pguhi2bqy7kdzo7e 0 2472350 8597750 2026-09-09T12:24:18Z FuzzyBot 451990 Updating to match new version of source page 8597750 wikitext text/x-wiki qzzw3ggr1ycvp7gddtajw1exa3keumn 1198 2472351 8597751 2026-09-09T12:24:32Z Wladek92 887141 Created page with "Les captures nommées préfixées avec $ sont utilisées ici." 8597751 wikitext text/x-wiki biv8xxi4m4j7qd9fi24zgomvf9mox99 1198 2472352 8597764 2026-09-09T12:27:41Z Wladek92 887141 Created page with "Valeur de pre pour l'élément insérable." 8597764 wikitext text/x-wiki pshw5icbntuo0yp4zksmflhk1co4ufc 8598720 8597764 2026-09-10T09:13:01Z Wladek92 887141 8598720 wikitext text/x-wiki 3jwffhlhudyfnyniu6xirwidyk5xn1q 1198 2472353 8597766 2026-09-09T12:28:05Z Wladek92 887141 Created page with "La valeur est insérée ''avant'' la position du curseur." 8597766 wikitext text/x-wiki bjo0gpdxof4qrinqlsjmqh2r0mz5iid 1198 2472354 8597769 2026-09-09T12:28:33Z Wladek92 887141 Created page with "Les captures nommées préfixées avec $1 sont utilisées ici." 8597769 wikitext text/x-wiki sw6v5nvnsjlkx9lqbpbiabf2xpkygiv 1198 2472355 8597771 2026-09-09T12:29:21Z Wladek92 887141 Created page with "Si elle n'est pas spécifiée, la valeur utilisée est celle de l'affichage." 8597771 wikitext text/x-wiki dhx6xu6afdw57wh9y3cz3acyx2ogort 1198 2472356 8597773 2026-09-09T12:30:00Z Wladek92 887141 Created page with "La valeur après l'élément insérable." 8597773 wikitext text/x-wiki pww0e9jtrl3qlspr5twwyt5h9jm8as3 8598575 8597773 2026-09-10T08:11:15Z Wladek92 887141 8598575 wikitext text/x-wiki insz1j6ld8gt0shdam4p1anljym9h2o 8598722 8598575 2026-09-10T09:13:08Z Wladek92 887141 8598722 wikitext text/x-wiki rlnzwdzixn4jm6osnlw7nnnyrt85mx8 1198 2472357 8597775 2026-09-09T12:30:07Z Wladek92 887141 Created page with "Value insérée après la position du curseur." 8597775 wikitext text/x-wiki d7dc05jho4o94spuhu7oebwf02d76x1 8597777 8597775 2026-09-09T12:30:37Z Wladek92 887141 8597777 wikitext text/x-wiki r23qqwoewvf4f1lth9u2z3xfowl0nvk 8597779 8597777 2026-09-09T12:32:39Z Wladek92 887141 8597779 wikitext text/x-wiki mhrsu9uq5yp5goopwrchqgyt9ftf51j 1198 2472358 8597781 2026-09-09T12:33:44Z Wladek92 887141 Created page with "Les captures nommées préfixées par $1 sont utilisées ici." 8597781 wikitext text/x-wiki qestpw9efyx5j9zjbtpjfej6xzj0o29 1198 2472359 8597783 2026-09-09T12:34:18Z Wladek92 887141 Created page with "Voici une liste de valideurs embarqués." 8597783 wikitext text/x-wiki ancsg5q3ftrpticqt6cffclrz4lkb75 1198 2472360 8597786 2026-09-09T12:37:47Z Wladek92 887141 Created page with "Veillez à ce que le nombre de parenthèses (ou de crochets) ouvrantes corresponde au nombre de parenthèses (ou de crochets) fermantes dans la traduction." 8597786 wikitext text/x-wiki ru0w3bzb92almqr6x54607b8jt8bpxo 1198 2472361 8597788 2026-09-09T12:38:21Z Wladek92 887141 Created page with "Par exemple, les traductions suivantes sont acceptées," 8597788 wikitext text/x-wiki 4fk6zzxl71nan0qnwz1jmlyn1mfa5mv 8598577 8597788 2026-09-10T08:12:35Z Wladek92 887141 8598577 wikitext text/x-wiki p1ta3p5lsx7ysr8vkroje75b3t1lcmw 1198 2472362 8597795 2026-09-09T12:39:15Z Wladek92 887141 Created page with "alors que les suivantes sont en faute," 8597795 wikitext text/x-wiki h507hwktl6h8h1kjs0bdt0gs9ne9d13 8598579 8597795 2026-09-10T08:12:42Z Wladek92 887141 8598579 wikitext text/x-wiki d0v6fcj6e4fa72vnzb5kk4w2xc60cjw 1198 2472363 8597797 2026-09-09T12:40:12Z Wladek92 887141 Created page with "Ce valideur ne peut pas être marqué ''élément insérable''." 8597797 wikitext text/x-wiki tg9h9qxb7whe15qpoe01z24jk4yxwo2 8598581 8597797 2026-09-10T08:13:12Z Wladek92 887141 8598581 wikitext text/x-wiki pvz1bde1goz4ddhk0nha6quvgnxzzo9 1198 2472364 8597799 2026-09-09T12:41:19Z Wladek92 887141 Created page with "Le valideur veille à ce que seul les caractères d'échappement spécifiés sont présents dans une traduction." 8597799 wikitext text/x-wiki du0vo2gsc60zo4d4c4izs5im8tgars5 8598583 8597799 2026-09-10T08:15:06Z Wladek92 887141 8598583 wikitext text/x-wiki qket86ile34czu73leondu3lasxzs71 1198 2472365 8597801 2026-09-09T12:41:45Z Wladek92 887141 Created page with "Les caractères d'échappement autorisés peuvent être spécifiés lors de l'ajout du valideur et ne peuvent inclure que :" 8597801 wikitext text/x-wiki m3v4ix2cvyv54dap4zrkp5iz1i0bhv6 8598585 8597801 2026-09-10T08:16:23Z Wladek92 887141 8598585 wikitext text/x-wiki n279f8h4cqniyih74rp52ixvqyrsd1b 1198 2472366 8597803 2026-09-09T12:42:09Z Wladek92 887141 Created page with "Cela fonctionne spécifiquement pour les groupes de messages basés sur GetText." 8597803 wikitext text/x-wiki s40qtrrj6tf4ffbiiir2kddmgtz3gi1 8598587 8597803 2026-09-10T08:17:21Z Wladek92 887141 8598587 wikitext text/x-wiki 5rsoc1c172kqpa9zjxjbzeyhw9webn1 8598726 8598587 2026-09-10T09:13:18Z Wladek92 887141 8598726 wikitext text/x-wiki 2z91dbo00rq9aifycbarrkvbihg0s6w 1198 2472367 8597809 2026-09-09T12:46:38Z Wladek92 887141 Created page with "Cela fonctionne particulièrement avec les groupes de messages basés sur GetText." 8597809 wikitext text/x-wiki by4g6c3fl1j5as9b8hb2xlhp0r04olt 8598589 8597809 2026-09-10T08:18:09Z Wladek92 887141 8598589 wikitext text/x-wiki 2u60h3xhl9rckt19liscvpv49fx13xa 1198 2472368 8597811 2026-09-09T12:47:15Z Wladek92 887141 Created page with "Assure que si la source ou la définition contiennent un pluriel dans le format - $1, la traduction doit également le contenir." 8597811 wikitext text/x-wiki 1frgilwl5nnanutgmtugbypy7fdrrqi 1198 2472369 8597813 2026-09-09T12:47:39Z Wladek92 887141 Created page with "En fonction de la langue, il vérifie également si la traduction a le nombre correct de formes plurielles." 8597813 wikitext text/x-wiki 0xlv78159jthzzyc0higq9smuvblmz2 8598592 8597813 2026-09-10T08:19:03Z Wladek92 887141 8598592 wikitext text/x-wiki fuezuf4zomf8awk2gjlucjizvyj556u 1198 2472370 8597815 2026-09-09T12:47:51Z Wladek92 887141 Created page with "Par exemple, l'anglais en a deux, mais l'hébreu en a quatre." 8597815 wikitext text/x-wiki ryh9xj7m4omjui6sqoff2kptzrhj0td 8598594 8597815 2026-09-10T08:20:32Z Wladek92 887141 8598594 wikitext text/x-wiki j5h0hpc3io20swlja00p902170ba9gq 1198 2472371 8597817 2026-09-09T12:48:27Z Wladek92 887141 Created page with "Un valideur générique réutilisable qui peut être utilisé pour spécifier les validations personnalisées et les éléments insérables." 8597817 wikitext text/x-wiki tn4ojtf0gkx1nz1zu4qs16ygu7xdhrd 1198 2472372 8597819 2026-09-09T12:48:57Z Wladek92 887141 Created page with "Par exemple, prenez la configuration suivante où le valideur est marqué comme élément insérable et appliqué," 8597819 wikitext text/x-wiki puy82ao3gjfxx4kya28jqk1a50hi4ou 1198 2472373 8597821 2026-09-09T12:50:13Z Wladek92 887141 Created page with "Compte tenu du message source suivant - $1 qui est en cours de traduction, celle-ci doit avoir les paramètres - $2 et $3." 8597821 wikitext text/x-wiki kycu952juioyrclpkoyhfycmtzx540n 8598596 8597821 2026-09-10T08:22:23Z Wladek92 887141 8598596 wikitext text/x-wiki l8ych7uzgr57hz3s6ayrn0thswyqmv5 8598598 8598596 2026-09-10T08:23:01Z Wladek92 887141 8598598 wikitext text/x-wiki pkmsoc2kv51eqss5xmgmdmh9tqt2mo1 1198 2472374 8597823 2026-09-09T12:51:20Z Wladek92 887141 Created page with "Ils seront également affichés comme des éléments insérables pour faciliter leur utilisation par les traducteurs dans les traductions." 8597823 wikitext text/x-wiki mgt5rcbzfp0585k857n3ds7cdc77pf7 1198 2472375 8597825 2026-09-09T12:51:33Z Wladek92 887141 Created page with "L'absence de ces paramètres entraînera l'affichage d'une erreur au traducteur." 8597825 wikitext text/x-wiki hot8duerl9s2ptbjt0ckqeebjomiu99 1198 2472376 8597827 2026-09-09T12:51:55Z Wladek92 887141 Created page with "C'est un validateur qui correspond aux variables ruby dans les traductions." 8597827 wikitext text/x-wiki obvlsahs4una32xk4tzw7jfhsn4ct4p 8598600 8597827 2026-09-10T08:23:49Z Wladek92 887141 8598600 wikitext text/x-wiki ezpzjuaccewinutwqrca0h9iy4a7fjz 1198 2472377 8597829 2026-09-09T12:52:05Z Wladek92 887141 Created page with "Ce valideur est un élément insérable." 8597829 wikitext text/x-wiki 7ekfve5mr4tdyy9742it3n6levucwc3 1198 2472378 8597831 2026-09-09T12:52:24Z Wladek92 887141 Created page with "Un validateur de variable insérable pour Ios." 8597831 wikitext text/x-wiki 9kgl27xn00ggtbysvki7iz7tbim8au0 8597833 8597831 2026-09-09T12:52:34Z Wladek92 887141 8597833 wikitext text/x-wiki ptokpm7n9uojv4el6h9lwzhaaxmamtv 1198 2472379 8597835 2026-09-09T12:52:41Z Wladek92 887141 Created page with "Ce valideur est un élément insérable." 8597835 wikitext text/x-wiki 7ekfve5mr4tdyy9742it3n6levucwc3 1198 2472380 8597837 2026-09-09T12:52:51Z Wladek92 887141 Created page with "Veille à ce que la traduction soit présente dans la liste des valeurs." 8597837 wikitext text/x-wiki rob2dd9ykxnd2468q86ygi108bfifzo 1198 2472381 8597839 2026-09-09T12:56:49Z Wladek92 887141 Created page with "Prend également un paramètre - $1 qui peut être soit $2 (''par défault'') ou $3." 8597839 wikitext text/x-wiki 4lny7qtaw8lj25g93oe4m974nmhp20u 8598604 8597839 2026-09-10T08:27:49Z Wladek92 887141 8598604 wikitext text/x-wiki jx30svfufssbzp5j0l2n6yhkgvmvshk 1198 2472382 8597841 2026-09-09T12:58:58Z Wladek92 887141 Created page with "Vérifie que la traduction a le même nombre de passages à la ligne que le message source au début et à la fin de la chaîne." 8597841 wikitext text/x-wiki 03h2y4gbu170nce0uhcvitt88lmu1kd 1198 2472383 8597843 2026-09-09T13:00:04Z Wladek92 887141 Created page with "Notez que les valeurs LTR ou RTL ne seront pas valables, puisque $1 vaut $2 par défaut." 8597843 wikitext text/x-wiki 0vvyyibf8q5yi6iuhf4s4rr3bppt88k 1198 2472384 8597845 2026-09-09T13:00:43Z Wladek92 887141 Created page with "Vérifie si la traduction utilise des liens non recommandés." 8597845 wikitext text/x-wiki 9fwqhtlmby2ju7fkun3qs46p4fx5o14 1198 2472385 8597847 2026-09-09T13:01:52Z Wladek92 887141 Created page with "Les liens valides sont ceux qui pointent vers les pages Special:, $1 ou des pages de projet via des messages MediaWiki comme $2." 8597847 wikitext text/x-wiki 6hi80p6gytr870poebhd0f32tpxloxg 8598738 8597847 2026-09-10T09:14:39Z Wladek92 887141 8598738 wikitext text/x-wiki dwjkem4krpgwroynmns4kbgj0b5fy5v 1198 2472386 8597849 2026-09-09T13:03:28Z Wladek92 887141 Created page with "Veille à ce que si la source ou la définition contiennent un espace de noms tel que $1 les traductions effectuées n'essayent pas de traduire les espaces de noms eux-mêmes." 8597849 wikitext text/x-wiki cbj9lxvrrilvitto8v4rz3h20kqggw6 8598608 8597849 2026-09-10T08:31:10Z Wladek92 887141 8598608 wikitext text/x-wiki 3qw0d11oyvdb4ewkh7b8pgj8ln2qazw 1198 2472387 8597851 2026-09-09T13:04:33Z Wladek92 887141 Created page with "C'est un valideur qui capte les paramètres du wiki dans les traductions." 8597851 wikitext text/x-wiki p0i4m5bop6owqf1nt77tac592j1kb5t 1198 2472388 8597853 2026-09-09T13:04:58Z Wladek92 887141 Created page with "Assure que si la source ou définition contiennent un $1, la traduction doit également l'avoir." 8597853 wikitext text/x-wiki 0ol98ykxd18su6207fi0cfkesrlfanp 1198 2472389 8597855 2026-09-09T13:05:38Z Wladek92 887141 Created page with "En fonction de la langue, on vérifie également si la traduction a le nombre correct de formes plurielles." 8597855 wikitext text/x-wiki habyz3xi2cfxzvjzaetwu7drv9qbe86 1198 2472390 8597857 2026-09-09T13:05:57Z Wladek92 887141 Created page with "Par exemple, l'anglais en a deux, mais l'hébreu en a trois." 8597857 wikitext text/x-wiki 7674wccbuk43oswym0xylbe4zrr206i 8598610 8597857 2026-09-10T08:39:07Z Wladek92 887141 8598610 wikitext text/x-wiki axnwpop6m1q0z5sgqju0kcizcew2pzx 1198 2472391 8597859 2026-09-09T13:07:26Z Wladek92 887141 Created page with "Fournit des validations pour les options d'expiration et les options de blocage des adresses IP spécifiées dans le noyau MediaWiki." 8597859 wikitext text/x-wiki somin4nw78y1zywkbxt5mk8yyizkjte 1198 2472392 8597861 2026-09-09T13:08:11Z Wladek92 887141 Created page with "Ils sont généralement dans le format," 8597861 wikitext text/x-wiki gg3utarzravdn0tdtn5llya8ummd7dt 8598613 8597861 2026-09-10T08:40:55Z Wladek92 887141 8598613 wikitext text/x-wiki fltu0dore0pu4kj02a7u9k10hd988dk 1198 2472393 8597863 2026-09-09T13:08:46Z Wladek92 887141 Created page with "Les validations garantissent que les traductions ont exactement le même nombre de paires clé-valeur." 8597863 wikitext text/x-wiki qhql7eq0gaz8giw4msqpt0ra3shha2b 8598615 8597863 2026-09-10T08:41:37Z Wladek92 887141 8598615 wikitext text/x-wiki ltl8ts88ubioa9k0wfeqvetm6b83xax 1198 2472394 8597865 2026-09-09T13:09:17Z Wladek92 887141 Created page with "Ces validations ne sont exécutées que sur les messages avec des clés," 8597865 wikitext text/x-wiki iolate4cg3ewi7igd9nrr6tz9bklz25 8598617 8597865 2026-09-10T08:42:01Z Wladek92 887141 8598617 wikitext text/x-wiki ftuvkl8clbnl6fz1whr2xxpexzqjrln 8598620 8598617 2026-09-10T08:44:14Z Wladek92 887141 8598620 wikitext text/x-wiki abrhc4dga52que0uvrg1o8o8js80m1i 1198 2472395 8597867 2026-09-09T13:09:42Z Wladek92 887141 Created page with "Ce valideur n'est pas un élément insérable." 8597867 wikitext text/x-wiki r64pmefhai34zbp24pkqfq2z8wjr76e 1198 2472396 8597869 2026-09-09T13:09:51Z Wladek92 887141 Created page with "Ce valideur n'est pas un élément insérable." 8597869 wikitext text/x-wiki r64pmefhai34zbp24pkqfq2z8wjr76e 1198 2472397 8597871 2026-09-09T13:10:01Z Wladek92 887141 Created page with "Ce valideur est un élément insérable." 8597871 wikitext text/x-wiki 7ekfve5mr4tdyy9742it3n6levucwc3 1198 2472398 8597873 2026-09-09T13:10:12Z Wladek92 887141 Created page with "Ce valideur est un élément insérable." 8597873 wikitext text/x-wiki 7ekfve5mr4tdyy9742it3n6levucwc3 1198 2472399 8597875 2026-09-09T13:10:15Z Wladek92 887141 Created page with "Ce valideur est un élément insérable." 8597875 wikitext text/x-wiki 7ekfve5mr4tdyy9742it3n6levucwc3 1198 2472400 8597877 2026-09-09T13:10:23Z Wladek92 887141 Created page with "Ce valideur n'est pas un élément insérable." 8597877 wikitext text/x-wiki r64pmefhai34zbp24pkqfq2z8wjr76e 1198 2472401 8597879 2026-09-09T13:11:02Z Wladek92 887141 Created page with "Par exemple, l'anglais en a deux, mais l'hébreu en a quatre." 8597879 wikitext text/x-wiki ryh9xj7m4omjui6sqoff2kptzrhj0td 1198 2472402 8597881 2026-09-09T13:11:49Z Wladek92 887141 Created page with "Mon Valideur Personnalisé" 8597881 wikitext text/x-wiki ke5rrg3lnza7r05nafo2qeftte4rdto 1198 2472403 8597883 2026-09-09T13:16:05Z Wladek92 887141 Created page with "Assure que la traduction a un certain contenu, et que ce contenu n'est pas seulement de l'espace blanc." 8597883 wikitext text/x-wiki g7x9famk1lioq5mhafrk0jgpwd8yysv 8598622 8597883 2026-09-10T08:45:00Z Wladek92 887141 8598622 wikitext text/x-wiki hr7y2dyp3rc0xb6uz90es4gi8pgk8fl 1198 2472404 8597886 2026-09-09T13:19:44Z Wladek92 887141 Created page with "Ce valideur vérifie dans les traductions les caractères manquants et inconnus dans le format du printf." 8597886 wikitext text/x-wiki g7rlbdtx7mojr2324vuswm87ps8effe 8598624 8597886 2026-09-10T08:46:20Z Wladek92 887141 8598624 wikitext text/x-wiki b1thjb0x5ybc0xhwqraofefulmmr5vq 8598750 8598624 2026-09-10T09:17:18Z Wladek92 887141 8598750 wikitext text/x-wiki 619aw07mziygs5cxfdoro08vum1zkrh 1198 2472405 8597888 2026-09-09T13:20:20Z Wladek92 887141 Created page with "Vérifie si une traduction utilise la chaîne $1 et suggère à la place au traducteur d'utiliser la chaîne mentionnée dans $2." 8597888 wikitext text/x-wiki dlyzcl15u8y6lqjswdfuspp1oj48a2a 1198 2472406 8597890 2026-09-09T13:20:50Z Wladek92 887141 Created page with "Cela fonctionne particulièrement avec les groupes de messages basés sur $1." 8597890 wikitext text/x-wiki bvyo5vi21s5eovrz7eruczqytx27m59 1198 2472407 8597892 2026-09-09T13:21:23Z Wladek92 887141 Created page with "Par exemple, l'anglais en a deux, mais l'hébreu en a trois." 8597892 wikitext text/x-wiki 7674wccbuk43oswym0xylbe4zrr206i 1198 2472408 8597894 2026-09-09T13:22:12Z Wladek92 887141 Created page with "L'interface utilisateur a été mise à jour pour faire la différence entre les erreurs et les avertissements." 8597894 wikitext text/x-wiki hv7ypauwbpi17h1v5idtvej92xkygy0 1198 2472409 8597896 2026-09-09T13:22:27Z Wladek92 887141 Created page with "Un avertissement et une erreur affichés en haut d'une traduction" 8597896 wikitext text/x-wiki 4u1f7xzhq7r4yshonei99buluzc6xho 1198 2472410 8597900 2026-09-09T13:39:42Z Wladek92 887141 Created page with "Par exemple dans la configuration suivante, le valideur validera les messages avec la clé - $1 et assurera que ses valeurs sont soit ''ltr'' soit ''rtl''." 8597900 wikitext text/x-wiki 281867wykjak68fnbqf472a8slinncj 8597902 8597900 2026-09-09T13:39:51Z Wladek92 887141 8597902 wikitext text/x-wiki j8emo83zkvjdgvfh8gs66b05605tjil 8598734 8597902 2026-09-10T09:14:15Z Wladek92 887141 8598734 wikitext text/x-wiki aani2kaebn9zmrjqkv0cqemt9z0p6a6 1198 2472411 8597904 2026-09-09T13:42:51Z Wladek92 887141 Created page with "Vérifie que la traduction a le même nombre de passages à la ligne que le source ou le message de définition ''au début de la chaîne''." 8597904 wikitext text/x-wiki hhgq0axfwtdtzzo1w732icw94szj1tm 8597908 8597904 2026-09-09T13:44:30Z Wladek92 887141 8597908 wikitext text/x-wiki o4uik88emn8b8m6471iqt360w00xd10 1198 2472412 8597906 2026-09-09T13:43:48Z Wladek92 887141 Created page with "Assure que si la source ou la définition contiennent un pluriel dans le format - $1, la traduction doit également le contenir." 8597906 wikitext text/x-wiki 1frgilwl5nnanutgmtugbypy7fdrrqi 1198 2472413 8597910 2026-09-09T13:45:47Z Wladek92 887141 Created page with "Cela permettra encore aux utilisateurs qui ont les droits $1 de sauvegarder la traduction même si elle contient des erreurs." 8597910 wikitext text/x-wiki t0ls2aih6f060tdezxtwbm0xlgzyxoj 8598626 8597910 2026-09-10T08:50:32Z Wladek92 887141 8598626 wikitext text/x-wiki 8zzsbmlgzu4nx2ianmnm6oxzxego6hs 1198 2472414 8597912 2026-09-09T13:46:54Z Wladek92 887141 Created page with "Pousser $1 dans $2." 8597912 wikitext text/x-wiki kdd8cqlys8ga7t0tprfrjp8yphimq4i 8598634 8597912 2026-09-10T08:55:06Z Wladek92 887141 8598634 wikitext text/x-wiki pyvm5ozbksmi8m7y8lt2ra7sdknem6e 1198 2472415 8597915 2026-09-09T13:47:48Z Wladek92 887141 Created page with "En outre, la validation est également effectuée sur le serveur lorsque l'utilisateur sauvegarde sa traduction." 8597915 wikitext text/x-wiki eqehk020fktld1ma0ny6oiool1kqaus 1198 2472416 8597918 2026-09-09T13:48:48Z Wladek92 887141 Created page with "Assure que si le source ou la définition contiennent un pluriel dans le format - $1, la traduction doit également le contenir." 8597918 wikitext text/x-wiki a129hkpqlim0r2jlumoilgn1nktm618 1198 2472417 8597930 2026-09-09T14:55:49Z Wladek92 887141 Created page with "En fonction de la langue on vérifie si la traduction a le nombre correct de formes plurielles." 8597930 wikitext text/x-wiki 11gmsttc9k8f5d05hquthg7nm4qw4d4 1198 2472418 8597932 2026-09-09T14:56:57Z Wladek92 887141 Created page with "En fonction de la langue, on vérifie également si la traduction a le nombre correct de formes plurielles." 8597932 wikitext text/x-wiki habyz3xi2cfxzvjzaetwu7drv9qbe86 1198 2472419 8597934 2026-09-09T14:59:48Z Wladek92 887141 Created page with "Durant la traduction, si une erreur apparaît , le bouton '''Enregistrer la traduction''' est désactivé sauf si l'utilisateur qui traduit a les droits $1." 8597934 wikitext text/x-wiki g6r3gdfcwhyxhs1mmpwfr7xno64ezo7 0 2472420 8597936 2026-09-09T15:04:59Z TCipriani (WMF) 2109303 Created page with "<!-- Pad for the Release Engineering Team weekly meeting Archive at: https://www.mediawiki.org/wiki/Wikimedia_Release_Engineering_Team/Checkin_archive Save for next time: --> = 2026-09-02 = * [https://www.mediawiki.org/wiki/Wikimedia_Release_Engineering_Team/Checkin_archive/2026-08-26 Last time] Tyler: I'm back! Thanks to Dan for helming this meeting (and braving Asana) in my absence (Bonus 🍥 for nice clean etherpad). Very cool to see the stuff that got done while..." 8597936 wikitext text/x-wiki 9hlmf9cegu7os38lyoi0vcbchgwpkyq 0 2472422 8597954 2026-09-09T18:06:16Z EBlackorby-WMF 18109000 page creation 8597954 wikitext text/x-wiki ha5whdrusvt2bo3wstxblhib2uq6ek1 8597987 8597954 2026-09-09T18:23:39Z EBlackorby-WMF 18109000 adding subpage 8597987 wikitext text/x-wiki ln51x0xzrbwaasvk641s58xrpgl501d 8598016 8597987 2026-09-09T18:57:34Z EBlackorby-WMF 18109000 EBlackorby-WMF moved page [[Readers/Reader Experience/Donor Experiences]] to [[Readers/Donor Experiences]]: Simplifying the page path 8597987 wikitext text/x-wiki ln51x0xzrbwaasvk641s58xrpgl501d 8598020 8598016 2026-09-09T19:20:11Z Jdlrobson 446645 Adjust heading level for better mobile display 8598020 wikitext text/x-wiki 9z51b77mr1q074sd9t8r71v9bgm1kse 8598021 8598020 2026-09-09T19:20:39Z Jdlrobson 446645 8598021 wikitext text/x-wiki 9kmd5dqmyxfagaqs6jmwpunp0tc5kfe 8598281 8598021 2026-09-09T22:48:45Z Shirayuki 472859 simplify translation units 8598281 wikitext text/x-wiki lt8oqim5jew78oi5ka2qrmqckt75q0g 1198 2472423 8597955 2026-09-09T18:10:15Z Dyolf77 (WMF) 17171605 Created page with "== ما هو المخطط؟ ==" 8597955 wikitext text/x-wiki avzz30z1t0lkvcnccghkp8aqp8ko7fi 0 2472424 8597956 2026-09-09T18:10:17Z Dyolf77 (WMF) 17171605 Created page with "== ما هو المخطط؟ ==" 8597956 wikitext text/x-wiki jwfq2rs9pw6d5edh2pn5ngnmz01zt3c 8597958 8597956 2026-09-09T18:11:37Z Dyolf77 (WMF) 17171605 Created page with "هذه الصفحة تشرح ما هي المخططات، وكيفية إنشائها أو تكييفها، وماذا تعني وسوم الترميز، وأين توجد المخططات الحالية، وتجيب عن الأسئلة الشائعة." 8597958 wikitext text/x-wiki rkp2o2jaqwzae6htkn45lk51lbyeelz 8597961 8597958 2026-09-09T18:13:08Z Dyolf77 (WMF) 17171605 Created page with "هذه الصفحة كُتبت لتوجيه المحررين المتمرسين في ويكيبيديا الذين يرغبون في إنشاء مخطط أو التعرف عليه بشكل أعمق." 8597961 wikitext text/x-wiki j9giajl9xtgx16k5mxkifnacclr123v 8597964 8597961 2026-09-09T18:14:23Z Dyolf77 (WMF) 17171605 Created page with "'''المخطط''' هو صفحة ويكي عادية، يكتبها ويصونها مجتمع ويكيبيديا، وتستخدمها ميزة «إرشاد المقالات» لتقديم التوجيه عندما ينشئ أحدهم نوعًا معينًا من المقالات، مثل مقالة عن شخص، أو فيلم، أو حيوان." 8597964 wikitext text/x-wiki 490zrg1u6wvwlrltf1ognkfstzrozt9 8597966 8597964 2026-09-09T18:15:30Z Dyolf77 (WMF) 17171605 Created page with "تستخدم ميزة «إرشاد المقالات» المخططات طوال سير عمل إنشاء المقالة: لتقييم خطر الملحوظية، والتحقق من صحة المصادر، وعرض نصائح الكتابة، وفتح المحرر المرئي بمحتوى ابتدائي جاهز." 8597966 wikitext text/x-wiki 4095wjj4bpiy845kebcsoy0or5so9pv 8597968 8597966 2026-09-09T18:15:40Z Dyolf77 (WMF) 17171605 Created page with "يتضمن المخطط:" 8597968 wikitext text/x-wiki 7jyzkx8nsfzp8rjgeyvn8w37e3zfwys 8597970 8597968 2026-09-09T18:16:59Z Dyolf77 (WMF) 17171605 Created page with "'''نصائح وإرشادات''' منسّقة مجتمعيًا لكتابة ذلك النوع من المقالات، تُصمم وفقًا لممارسات الويكيبيديا المحددة" 8597970 wikitext text/x-wiki np63akwnv5gvpjxpt4oyr5g6lzhwe0e 8597972 8597970 2026-09-09T18:18:21Z Dyolf77 (WMF) 17171605 Created page with "و'''مصادر موصى بها وأخرى غير مرغوب فيها''' يتفق عليها المجتمع لذلك النوع" 8597972 wikitext text/x-wiki mrltjjts9saz5itsxocz69rd5jg1apx 8597974 8597972 2026-09-09T18:18:46Z Dyolf77 (WMF) 17171605 Created page with "و'''أقسامًا مقترحة''' ومحتوى ابتدائي نموذجي." 8597974 wikitext text/x-wiki fqpl2invoalq5mh8a7022sjkfvbi82r 8597976 8597974 2026-09-09T18:21:03Z Dyolf77 (WMF) 17171605 Created page with "ولأن المخططات هي صفحات ويكي عادية، فأي محرر لديه الصلاحيات المناسبة يمكنه إنشاؤها أو تحسينها تمامًا مثل أي صفحة أخرى." 8597976 wikitext text/x-wiki nap48z6qainj9vgt4m611v11gmmy5lm 8597978 8597976 2026-09-09T18:21:38Z Dyolf77 (WMF) 17171605 Created page with "ما يميز المخططات هو ترميزها الخاص، الذي يخبر الميزة بكيفية التصرف لذلك النوع من المقالات في تلك الويكيبيديا." 8597978 wikitext text/x-wiki 3ym8bb7cqr4hl3hi81y8n181qxvnjip 8597980 8597978 2026-09-09T18:21:48Z Dyolf77 (WMF) 17171605 Created page with "== كيفية إنشاء مخطط ==" 8597980 wikitext text/x-wiki e8xiw4efoug3jnegcv35tare4ypflcy 8597982 8597980 2026-09-09T18:22:14Z Dyolf77 (WMF) 17171605 Created page with "هناك طريقتان لإنشاء مخطط: تكييف مخطط موجود من ويكيبيديا أخرى، أو البدء من الصفر." 8597982 wikitext text/x-wiki pn8wyomv2ujthdyjtugqwmdutr38wia 8597984 8597982 2026-09-09T18:22:45Z Dyolf77 (WMF) 17171605 Created page with "تكييف مخطط موجود" 8597984 wikitext text/x-wiki 4ori10n2jv6nlas6d4ezsqiv10jattc 8597986 8597984 2026-09-09T18:23:02Z Dyolf77 (WMF) 17171605 Created page with "هذه هي نقطة البداية الموصى بها." 8597986 wikitext text/x-wiki aihg2n7wmautcdg59ye0eq9kthfp9ab 8597990 8597986 2026-09-09T18:26:31Z Dyolf77 (WMF) 17171605 Created page with "تفضلوا بزيارة [[:simple:Wikipedia:Article_Guidance|صفحة المخططات في ويكيبيديا الإنجليزية البسيطة]] (أو أي ويكيبيديا أخرى لديها مخططات) واختاروا مخططًا يناسب نوع المقالة التي تريدون دعمها، على سبيل المثال: [[:simple:Wikipedia:Article_Guidance/Person|Wikipedia:Article Guidance/Person]]." 8597990 wikitext text/x-wiki hxdenk0mp8eoohk6agb6nnxzlq9zsvu 8597992 8597990 2026-09-09T18:26:51Z Dyolf77 (WMF) 17171605 8597992 wikitext text/x-wiki 88sv53gbavypzucl3jwmkho9kwv227l 8597994 8597992 2026-09-09T18:27:29Z Dyolf77 (WMF) 17171605 8597994 wikitext text/x-wiki hxdenk0mp8eoohk6agb6nnxzlq9zsvu 8597996 8597994 2026-09-09T18:28:07Z Dyolf77 (WMF) 17171605 Created page with "افتحوا المخطط في وضع «عدل المصدر» وانسخوا المحتوى بالكامل، بما في ذلك جميع الوسوم مثل $1." 8597996 wikitext text/x-wiki cvbwa7vqzji9sugsirc63a6rqgmnxbk 8597998 8597996 2026-09-09T18:30:45Z Dyolf77 (WMF) 17171605 Created page with "لا تقوموا بحذف أو تعديل الوسوم نفسها، بل عدّلوا النص الموجود بداخلها فقط." 8597998 wikitext text/x-wiki 6p0zntp62ajbew655suwftebg0z9drw 8598000 8597998 2026-09-09T18:31:20Z Dyolf77 (WMF) 17171605 Created page with "أنشؤوا صفحة جديدة في نطاق مشروع ويكيبيديتكم باستخدام صيغة التسمية الموصى بها." 8598000 wikitext text/x-wiki 3hz3z4pht6v6q9fybu4e5ds1unxg96i 8598002 8598000 2026-09-09T18:31:42Z Dyolf77 (WMF) 17171605 Created page with "اطلعوا على {{$1|المخططات الموجودة}} للاطلاع على اصطلاحات التسمية المستخدمة في مختلف الويكيبيديات." 8598002 wikitext text/x-wiki k6pouo67990pq9pvev4n1qfxapx6bx5 8598004 8598002 2026-09-09T18:32:16Z Dyolf77 (WMF) 17171605 Created page with "الصقوا المحتوى المنسوخ في صفحتكم الجديدة." 8598004 wikitext text/x-wiki coalfqjqahhqgz5tf21egned9x5e49d 8598006 8598004 2026-09-09T18:33:03Z Dyolf77 (WMF) 17171605 Created page with "ترجموا وعدّلوا الصياغة والمصادر وهيكل الأقسام لتعكس معايير مجتمعكم وسياساته وأسلوب كتابته." 8598006 wikitext text/x-wiki qzkm9aqwl1jngg3hox02cs1ya3hirga 8598008 8598006 2026-09-09T18:33:19Z Dyolf77 (WMF) 17171605 Created page with "انشروا الصفحة." 8598008 wikitext text/x-wiki btn9dxkb6r8qfrm4p65rf772b149c9n 8598010 8598008 2026-09-09T18:34:22Z Dyolf77 (WMF) 17171605 Created page with "إلى أن يتم نشر الامتداد بالكامل في الويكي الخاص بكم، قد تظهر الصفحة بشكل غير معتاد بعد النشر." 8598010 wikitext text/x-wiki iezhrdxfzp4d2gb89v13cvgn5asffmr 8598012 8598010 2026-09-09T18:34:41Z Dyolf77 (WMF) 17171605 Created page with "هذا أمر متوقع ولا يشير إلى وجود مشكلة." 8598012 wikitext text/x-wiki 3xq4rbdsi8bqmktg6xz1bdk5ixo5ey0 8598014 8598012 2026-09-09T18:35:00Z Dyolf77 (WMF) 17171605 Created page with "إنشاء مخطط من الصفر" 8598014 wikitext text/x-wiki nm2f7bopc2yantyx46optyzw68smnbn 8598821 8598014 2026-09-10T11:20:12Z Dyolf77 (WMF) 17171605 Created page with "إذا لم يكن هناك مخطط موجود يناسب احتياجاتكم، يمكنكم إنشاء صفحة جديدة وإضافة الترميز المطلوب بنفسكم." 8598821 wikitext text/x-wiki d8kzisvkjiq18jct9uqey22r2bufm04 8598823 8598821 2026-09-10T11:20:55Z Dyolf77 (WMF) 17171605 Created page with "ستحتاجون إلى تحديد عنصر ويكي بيانات الصحيح لنوع المقالة الذي تريدون دعمه، فهذا يخبر الميزة متى تعرض المخطط الخاص بكم." 8598823 wikitext text/x-wiki 4j7t5bn1ukhfum1rddvl5iscttnc9o2 8598825 8598823 2026-09-10T11:21:20Z Dyolf77 (WMF) 17171605 Created page with "الاطلاع على {{$1|دليل الترميز}} للحصول على المرجع الكامل للترميز." 8598825 wikitext text/x-wiki fc158s0knke6o4n0fs6zbwiz4odwud3 8598827 8598825 2026-09-10T11:21:32Z Dyolf77 (WMF) 17171605 Created page with "يعرض الفيديو أدناه العملية خطوة بخطوة لإنشاء مخطط." 8598827 wikitext text/x-wiki k3yi7dsexm8s0wx5mblaqgijqqiebug 8598829 8598827 2026-09-10T11:21:54Z Dyolf77 (WMF) 17171605 Created page with "هذا الفيديو يوضح كيفية إنشاء مخططات لميزة إرشاد المقالات" 8598829 wikitext text/x-wiki i6nvyt6uumbfpedsp4mefn216hfx138 8598831 8598829 2026-09-10T11:22:08Z Dyolf77 (WMF) 17171605 Created page with "=== دليل الترميز ===" 8598831 wikitext text/x-wiki 3q4s7k3bl1gu7sxsg6q69aeqa9oad5r 8598833 8598831 2026-09-10T11:22:17Z Dyolf77 (WMF) 17171605 Created page with "يستخدم كل مخطط مجموعة محددة من الوسوم." 8598833 wikitext text/x-wiki l0ioybqlercvauye8xkgxosoze1fy8s 8598835 8598833 2026-09-10T11:22:38Z Dyolf77 (WMF) 17171605 Created page with "يُطلب من المحررين الإبقاء على الوسوم دون تغيير وتعديل النص الموجود داخلها فقط." 8598835 wikitext text/x-wiki bfak3gp16qsgr4dncgngexrttitvhp8 8598837 8598835 2026-09-10T11:22:49Z Dyolf77 (WMF) 17171605 Created page with "فيما يلي الترميزات التي يجب تضمينها في المخطط:" 8598837 wikitext text/x-wiki j15uvmn27ir4uzgd48pasm8jfw2z14y 8598839 8598837 2026-09-10T11:23:09Z Dyolf77 (WMF) 17171605 Created page with "=== المخططات الموجودة ===" 8598839 wikitext text/x-wiki brb0p94923po2d0ozhu2j4vrhlerfov 8598841 8598839 2026-09-10T11:24:00Z Dyolf77 (WMF) 17171605 Created page with "انظروا [[$1|صفحة إرشاد المقالات]]." 8598841 wikitext text/x-wiki 64ixjddfjixjj8ldui3bkq9iegqifyh 8598843 8598841 2026-09-10T11:24:05Z Dyolf77 (WMF) 17171605 Created page with "=== عناصر ويكي بيانات ===" 8598843 wikitext text/x-wiki 8rytedefmnnvpdkchdcclcatmeqfdgk 8598845 8598843 2026-09-10T11:24:55Z Dyolf77 (WMF) 17171605 Created page with "للقائمة الرئيسية وعناصر ويكي بيانات التي يتصل بها كل مخطط، تفضلوا بزيارة [[$1|عنصر ويكي بيانات]] هذا." 8598845 wikitext text/x-wiki gyem6zzyt89h5bfsfaj7r7wtvuxkvbm 8598847 8598845 2026-09-10T11:25:09Z Dyolf77 (WMF) 17171605 Created page with "== الأسئلة الشائعة حول المخططات ==" 8598847 wikitext text/x-wiki g5374ua0m2ewpyschu4yuzrywfuvxto 8598849 8598847 2026-09-10T11:25:26Z Dyolf77 (WMF) 17171605 Created page with "هل أحتاج إلى إذن من الفريق الذي طوّر الميزة لإنشاء أو تعديل مخطط؟" 8598849 wikitext text/x-wiki 1enczqj9l4nhvln3ewx3abjxxolpkbi 8598851 8598849 2026-09-10T11:26:12Z Dyolf77 (WMF) 17171605 Created page with "لا. المخططات هي صفحات ويكي عادية، وأي مساهم لديه الصلاحيات العادية لإنشاء أو تعديل الصفحات في مشروع ويكيبيديا يمكنه إنشاء مخطط أو تحسينه." 8598851 wikitext text/x-wiki ilpz4692rtuqnw32uv4bqsjwky5oi0u 8598853 8598851 2026-09-10T11:26:26Z Dyolf77 (WMF) 17171605 Created page with "ماذا لو لم يكن هناك نوع مقالة في الميزة يطابق ما أريد كتابته؟" 8598853 wikitext text/x-wiki ke4fysg6auql5j2eis9udemuiob91rg 8598855 8598853 2026-09-10T11:27:15Z Dyolf77 (WMF) 17171605 Created page with "يمكنكم إنشاء مخطط جديد لذلك النوع إذا كان لديكم فهم جيد للممارسات والسياسات المطبقة على ذلك النوع من المقالات في مشروع ويكيبيديا الخاص بكم." 8598855 wikitext text/x-wiki 9ylmta6u7qizld847xzvsh8ltllw1jo 8598857 8598855 2026-09-10T11:29:58Z Dyolf77 (WMF) 17171605 Created page with "أولاً، ابحثوا عن[[$1|عنصر ويكي بيانات]] المطابق أو أنشؤوه، ثم انشؤوا المخطط باتباع التعليمات الخاصة بإنشاء مخطط." 8598857 wikitext text/x-wiki b9kfgsk9qzhooaezchxtbi2ik8ohihz 8598859 8598857 2026-09-10T11:30:49Z Dyolf77 (WMF) 17171605 Created page with "إلى أن يوجد مخطط، سيرى المحررون رسالة «تعذر العثور على نوع مقالة مطابق» في الميزة ويمكنهم إما اختيار أقرب نوع موجود أو الخروج دون توجيه." 8598859 wikitext text/x-wiki 46s9sn7v9lkr6asp7nu54oodsn2ckca 8598861 8598859 2026-09-10T11:31:11Z Dyolf77 (WMF) 17171605 Created page with "هل يمكنني جعل مخطط واحد يغطي موضوعًا واسعًا جدًا، بحيث لا يضيع أي موضوع؟" 8598861 wikitext text/x-wiki d5rp45d6b36thnlgzjohvxan0wcnx80 8598863 8598861 2026-09-10T11:31:25Z Dyolf77 (WMF) 17171605 Created page with "نعم، من الناحية التقنية يمكنكم ربط مخطط بمفهوم واسع في ويكي بيانات." 8598863 wikitext text/x-wiki rxaue4htbev0erhbxfl13wo7f4t0xiv 8598865 8598863 2026-09-10T11:31:43Z Dyolf77 (WMF) 17171605 Created page with "ولكن نظرًا لأنه يغطي نطاقًا كبيرًا، فإن النصائح التي يمكن أن يقدمها ستكون عامة بالضرورة." 8598865 wikitext text/x-wiki jd9uv9uwkw920g1notw7alduilvj91d 8598867 8598865 2026-09-10T11:32:13Z Dyolf77 (WMF) 17171605 Created page with "'''من الأفضل الاستمرار في إنشاء مخططات محددة بمرور الوقت بدلاً من الاعتماد على مخطط واحد شامل'''، لأن القواعد تختلف بين أنواع المقالات المختلفة." 8598867 wikitext text/x-wiki rla9i190v4iiwru8iy9wlt8hfi1lphy 1198 2472425 8597957 2026-09-09T18:11:36Z Dyolf77 (WMF) 17171605 Created page with "هذه الصفحة تشرح ما هي المخططات، وكيفية إنشائها أو تكييفها، وماذا تعني وسوم الترميز، وأين توجد المخططات الحالية، وتجيب عن الأسئلة الشائعة." 8597957 wikitext text/x-wiki fbjbl2nwpf7o8ewh1nplxoiyai97in8 1198 2472426 8597959 2026-09-09T18:12:23Z Dyolf77 (WMF) 17171605 Created page with "إرشاد المقالات/كيفية إنشاء مخطط" 8597959 wikitext text/x-wiki 25v14r137tzo8vbt6r7hndon21nxxz2 1198 2472427 8597960 2026-09-09T18:13:07Z Dyolf77 (WMF) 17171605 Created page with "هذه الصفحة كُتبت لتوجيه المحررين المتمرسين في ويكيبيديا الذين يرغبون في إنشاء مخطط أو التعرف عليه بشكل أعمق." 8597960 wikitext text/x-wiki a42ytan5735xc3sl2jm1b3zdlfyentm 1198 2472428 8597963 2026-09-09T18:14:21Z Dyolf77 (WMF) 17171605 Created page with "'''المخطط''' هو صفحة ويكي عادية، يكتبها ويصونها مجتمع ويكيبيديا، وتستخدمها ميزة «إرشاد المقالات» لتقديم التوجيه عندما ينشئ أحدهم نوعًا معينًا من المقالات، مثل مقالة عن شخص، أو فيلم، أو حيوان." 8597963 wikitext text/x-wiki dc0tmij2aamgai5kqezt1hfducp2a54 1198 2472429 8597965 2026-09-09T18:15:29Z Dyolf77 (WMF) 17171605 Created page with "تستخدم ميزة «إرشاد المقالات» المخططات طوال سير عمل إنشاء المقالة: لتقييم خطر الملحوظية، والتحقق من صحة المصادر، وعرض نصائح الكتابة، وفتح المحرر المرئي بمحتوى ابتدائي جاهز." 8597965 wikitext text/x-wiki b5atw72j596vmilfgcmx6jyrykqxhjy 1198 2472430 8597967 2026-09-09T18:15:38Z Dyolf77 (WMF) 17171605 Created page with "يتضمن المخطط:" 8597967 wikitext text/x-wiki orohe34rfkxpthxy80wc5rk3crpl0eq 1198 2472431 8597969 2026-09-09T18:16:58Z Dyolf77 (WMF) 17171605 Created page with "'''نصائح وإرشادات''' منسّقة مجتمعيًا لكتابة ذلك النوع من المقالات، تُصمم وفقًا لممارسات الويكيبيديا المحددة" 8597969 wikitext text/x-wiki n66696r8uqkho5up6at2r6hsxp0mz4c 1198 2472432 8597971 2026-09-09T18:18:20Z Dyolf77 (WMF) 17171605 Created page with "و'''مصادر موصى بها وأخرى غير مرغوب فيها''' يتفق عليها المجتمع لذلك النوع" 8597971 wikitext text/x-wiki sipck268q36psv480qr8ozqh64f2z1f 1198 2472433 8597973 2026-09-09T18:18:45Z Dyolf77 (WMF) 17171605 Created page with "و'''أقسامًا مقترحة''' ومحتوى ابتدائي نموذجي." 8597973 wikitext text/x-wiki h3308fjm3oil79pankkht4bwg6dstew 1198 2472434 8597975 2026-09-09T18:21:01Z Dyolf77 (WMF) 17171605 Created page with "ولأن المخططات هي صفحات ويكي عادية، فأي محرر لديه الصلاحيات المناسبة يمكنه إنشاؤها أو تحسينها تمامًا مثل أي صفحة أخرى." 8597975 wikitext text/x-wiki semmte6nh217upfxnxdx9xqrjnkjpct 1198 2472435 8597977 2026-09-09T18:21:37Z Dyolf77 (WMF) 17171605 Created page with "ما يميز المخططات هو ترميزها الخاص، الذي يخبر الميزة بكيفية التصرف لذلك النوع من المقالات في تلك الويكيبيديا." 8597977 wikitext text/x-wiki 6j4sgwfnmd7sqvguar7omcypq499tm8 1198 2472436 8597979 2026-09-09T18:21:46Z Dyolf77 (WMF) 17171605 Created page with "== كيفية إنشاء مخطط ==" 8597979 wikitext text/x-wiki t3zqy49hlpxa4ztbaim1eecwzvyzf8t 1198 2472437 8597981 2026-09-09T18:22:13Z Dyolf77 (WMF) 17171605 Created page with "هناك طريقتان لإنشاء مخطط: تكييف مخطط موجود من ويكيبيديا أخرى، أو البدء من الصفر." 8597981 wikitext text/x-wiki 1drwfs5tqnylvb13qm21qp2078hjllq 1198 2472438 8597983 2026-09-09T18:22:44Z Dyolf77 (WMF) 17171605 Created page with "تكييف مخطط موجود" 8597983 wikitext text/x-wiki qvzl6qzfh9kzzqy7oq5cgxw4p4n8gqr 1198 2472439 8597985 2026-09-09T18:23:01Z Dyolf77 (WMF) 17171605 Created page with "هذه هي نقطة البداية الموصى بها." 8597985 wikitext text/x-wiki bnmvln75q328jhyfyd5cpf4jqp3qzwd 1198 2472440 8597989 2026-09-09T18:26:31Z Dyolf77 (WMF) 17171605 Created page with "تفضلوا بزيارة [[:simple:Wikipedia:Article_Guidance|صفحة المخططات في ويكيبيديا الإنجليزية البسيطة]] (أو أي ويكيبيديا أخرى لديها مخططات) واختاروا مخططًا يناسب نوع المقالة التي تريدون دعمها، على سبيل المثال: [[:simple:Wikipedia:Article_Guidance/Person|Wikipedia:Article Guidance/Person]]." 8597989 wikitext text/x-wiki kmdki95wwesuq5fofmw4f1lirm4zzbz 8597991 8597989 2026-09-09T18:26:50Z Dyolf77 (WMF) 17171605 8597991 wikitext text/x-wiki i5z8hbjc2hbz6gvmltinbkf8ljpwk6v 8597993 8597991 2026-09-09T18:27:28Z Dyolf77 (WMF) 17171605 8597993 wikitext text/x-wiki kmdki95wwesuq5fofmw4f1lirm4zzbz 1198 2472441 8597995 2026-09-09T18:28:04Z Dyolf77 (WMF) 17171605 Created page with "افتحوا المخطط في وضع «عدل المصدر» وانسخوا المحتوى بالكامل، بما في ذلك جميع الوسوم مثل $1." 8597995 wikitext text/x-wiki ljwjvquodxa3hej8bdebqrsndgktfyb 1198 2472442 8597997 2026-09-09T18:30:44Z Dyolf77 (WMF) 17171605 Created page with "لا تقوموا بحذف أو تعديل الوسوم نفسها، بل عدّلوا النص الموجود بداخلها فقط." 8597997 wikitext text/x-wiki a34ica8jk6qmczcocq5ructeofd1py0 1198 2472443 8597999 2026-09-09T18:31:19Z Dyolf77 (WMF) 17171605 Created page with "أنشؤوا صفحة جديدة في نطاق مشروع ويكيبيديتكم باستخدام صيغة التسمية الموصى بها." 8597999 wikitext text/x-wiki kxo4noaare2ekzy83uplcmj40gbnyw0 1198 2472444 8598001 2026-09-09T18:31:41Z Dyolf77 (WMF) 17171605 Created page with "اطلعوا على {{$1|المخططات الموجودة}} للاطلاع على اصطلاحات التسمية المستخدمة في مختلف الويكيبيديات." 8598001 wikitext text/x-wiki j9iaaywidf9g6pkfj6hewkrjneriizs 1198 2472445 8598003 2026-09-09T18:32:15Z Dyolf77 (WMF) 17171605 Created page with "الصقوا المحتوى المنسوخ في صفحتكم الجديدة." 8598003 wikitext text/x-wiki rhe3a4rcrgdmg73haca7hpl7pb4yz47 1198 2472446 8598005 2026-09-09T18:33:02Z Dyolf77 (WMF) 17171605 Created page with "ترجموا وعدّلوا الصياغة والمصادر وهيكل الأقسام لتعكس معايير مجتمعكم وسياساته وأسلوب كتابته." 8598005 wikitext text/x-wiki jv9iznldsq30gjjhwlthb7jy4mp1zhf 1198 2472447 8598007 2026-09-09T18:33:19Z Dyolf77 (WMF) 17171605 Created page with "انشروا الصفحة." 8598007 wikitext text/x-wiki k75ir5wghkv7mdwm4v21geyaw1ya7t1 1198 2472448 8598009 2026-09-09T18:34:22Z Dyolf77 (WMF) 17171605 Created page with "إلى أن يتم نشر الامتداد بالكامل في الويكي الخاص بكم، قد تظهر الصفحة بشكل غير معتاد بعد النشر." 8598009 wikitext text/x-wiki 3ue0v6yy9fnr9s906f9tv6cwi2nqm8h 1198 2472449 8598011 2026-09-09T18:34:40Z Dyolf77 (WMF) 17171605 Created page with "هذا أمر متوقع ولا يشير إلى وجود مشكلة." 8598011 wikitext text/x-wiki 8rod463d3de1y27cnn2yax1o5mewa4s 1198 2472450 8598013 2026-09-09T18:34:59Z Dyolf77 (WMF) 17171605 Created page with "إنشاء مخطط من الصفر" 8598013 wikitext text/x-wiki 2fdlwru7xy55j5mxor06y70sns93owl 0 2472451 8598017 2026-09-09T18:57:35Z EBlackorby-WMF 18109000 EBlackorby-WMF moved page [[Readers/Reader Experience/Donor Experiences]] to [[Readers/Donor Experiences]]: Simplifying the page path 8598017 wikitext text/x-wiki musx5b1jb2uuc75xtjwimw5xq3147h4 1198 2472452 8598024 2026-09-09T19:38:53Z Armin hpj 17945789 Created page with "آغاز:" 8598024 wikitext text/x-wiki g2c0z8fyfo6xv5w19y75nfbwqqr3gp7 0 2472453 8598025 2026-09-09T19:38:53Z Armin hpj 17945789 Created page with "آغاز:" 8598025 wikitext text/x-wiki i0i39iiqiymqgkrywcdscamvuvd1el4 8598029 8598025 2026-09-09T19:39:13Z Armin hpj 17945789 Created page with "پایان:" 8598029 wikitext text/x-wiki jmcxfn8yuf1i37w03f0hkkmejv975u6 8598031 8598029 2026-09-09T19:39:23Z Armin hpj 17945789 Created page with "مکان:" 8598031 wikitext text/x-wiki fxl8gph29obba629avpgkddtsq11x5x 8598033 8598031 2026-09-09T19:39:47Z Armin hpj 17945789 Created page with "کنفرانس قبلی:" 8598033 wikitext text/x-wiki 7yg3k546vsp08352fbc9df1lwkvlhsb 8598035 8598033 2026-09-09T19:40:00Z Armin hpj 17945789 Created page with "کنفرانس بعدی:" 8598035 wikitext text/x-wiki qfcvusnevem3qpe9rmob2uiuh92y1ip 8598037 8598035 2026-09-09T19:40:27Z Armin hpj 17945789 Created page with "۱۱-۱۳ نوامبر ۲۰۲۶" 8598037 wikitext text/x-wiki 4kh1a5nb1kr5tvp9tjom6j1qs3e4a5e 8598039 8598037 2026-09-09T19:40:34Z Armin hpj 17945789 Created page with "مکان:" 8598039 wikitext text/x-wiki fwvjkjpcvd4t6hdach64kpww19elzjl 8598041 8598039 2026-09-09T19:40:40Z Armin hpj 17945789 Created page with "تاریخ‌ها:" 8598041 wikitext text/x-wiki cjt9gnv3y2k2x5rtsx4ts7m93p12bs8 8598043 8598041 2026-09-09T19:41:34Z Armin hpj 17945789 Created page with "== برگزارکنندگان ==" 8598043 wikitext text/x-wiki orf1u2g5kcfblhlbq58v9lz7aa4htv4 8598045 8598043 2026-09-09T19:41:54Z Armin hpj 17945789 Created page with "== برنامه ==" 8598045 wikitext text/x-wiki 7eo6wojuofy53qy5c073vnj7y3zskqt 14 2472454 8598026 2026-09-09T19:38:54Z FuzzyBot 451990 Automatically creating translation of category used on [[MediaWiki Users and Developers Conference Fall 2026/fa]] 8598026 wikitext text/x-wiki 8gv91fthozszv39wwends8s6tdwfmqw 14 2472455 8598027 2026-09-09T19:38:54Z FuzzyBot 451990 Automatically creating translation of category used on [[MediaWiki Users and Developers Conference Fall 2026/fa]] 8598027 wikitext text/x-wiki s19s4nc86muryn4zeq6owqm7qruenx9 1198 2472456 8598028 2026-09-09T19:39:12Z Armin hpj 17945789 Created page with "پایان:" 8598028 wikitext text/x-wiki 03bm17io8ahqb5ytr6wem5lqbs3tltk 1198 2472457 8598030 2026-09-09T19:39:22Z Armin hpj 17945789 Created page with "مکان:" 8598030 wikitext text/x-wiki 9xxkukr3c4o1kjvc37eixzvitbmn1em 1198 2472458 8598032 2026-09-09T19:39:47Z Armin hpj 17945789 Created page with "کنفرانس قبلی:" 8598032 wikitext text/x-wiki 9q0b8ficv2mpr9r0tglvfxif10484el 1198 2472459 8598034 2026-09-09T19:39:59Z Armin hpj 17945789 Created page with "کنفرانس بعدی:" 8598034 wikitext text/x-wiki lavzvdsxphubrosl4bakks3hbumbpg7 1198 2472460 8598036 2026-09-09T19:40:27Z Armin hpj 17945789 Created page with "۱۱-۱۳ نوامبر ۲۰۲۶" 8598036 wikitext text/x-wiki phm9ygdp8l4ddpceabx8gaq8rz061m7 1198 2472461 8598038 2026-09-09T19:40:33Z Armin hpj 17945789 Created page with "مکان:" 8598038 wikitext text/x-wiki 9xxkukr3c4o1kjvc37eixzvitbmn1em 1198 2472462 8598040 2026-09-09T19:40:39Z Armin hpj 17945789 Created page with "تاریخ‌ها:" 8598040 wikitext text/x-wiki tnc8dv1n65s6dcdibgkp3ji9t20z53b 1198 2472463 8598042 2026-09-09T19:41:33Z Armin hpj 17945789 Created page with "== برگزارکنندگان ==" 8598042 wikitext text/x-wiki q01llhzj91qccnc1lwaga4bdkop07s6 1198 2472464 8598044 2026-09-09T19:41:54Z Armin hpj 17945789 Created page with "== برنامه ==" 8598044 wikitext text/x-wiki 9f2u732029p3hspedfm35591x6raszy 1198 2472465 8598046 2026-09-09T19:42:59Z Armin hpj 17945789 Created page with "آغاز:" 8598046 wikitext text/x-wiki g2c0z8fyfo6xv5w19y75nfbwqqr3gp7 0 2472466 8598047 2026-09-09T19:43:00Z Armin hpj 17945789 Created page with "آغاز:" 8598047 wikitext text/x-wiki b4ty820uu2d6ncgj446nrqclaw9ugim 8598049 8598047 2026-09-09T19:43:03Z Armin hpj 17945789 Created page with "پایان:" 8598049 wikitext text/x-wiki qcgwe1jfrvgxkwh2d48c8w7hxgxfe8l 8598051 8598049 2026-09-09T19:43:21Z Armin hpj 17945789 Created page with "کنفرانس قبلی:" 8598051 wikitext text/x-wiki mwfafrjc6hwvfeb85sjboswfmqeeqwx 8598053 8598051 2026-09-09T19:43:24Z Armin hpj 17945789 Created page with "کنفرانس بعدی:" 8598053 wikitext text/x-wiki 3ok29urzhptog60ap1y3hdabpe6tkmq 8598055 8598053 2026-09-09T19:43:34Z Armin hpj 17945789 Created page with "مکان:" 8598055 wikitext text/x-wiki 4uakjqzqeslxe4mmp2pnh97px4d6pfg 1198 2472467 8598048 2026-09-09T19:43:03Z Armin hpj 17945789 Created page with "پایان:" 8598048 wikitext text/x-wiki 03bm17io8ahqb5ytr6wem5lqbs3tltk 1198 2472468 8598050 2026-09-09T19:43:20Z Armin hpj 17945789 Created page with "کنفرانس قبلی:" 8598050 wikitext text/x-wiki 9q0b8ficv2mpr9r0tglvfxif10484el 1198 2472469 8598052 2026-09-09T19:43:24Z Armin hpj 17945789 Created page with "کنفرانس بعدی:" 8598052 wikitext text/x-wiki lavzvdsxphubrosl4bakks3hbumbpg7 1198 2472470 8598054 2026-09-09T19:43:34Z Armin hpj 17945789 Created page with "مکان:" 8598054 wikitext text/x-wiki 9xxkukr3c4o1kjvc37eixzvitbmn1em 1198 2472471 8598056 2026-09-09T19:44:39Z Armin hpj 17945789 Created page with "مکان:" 8598056 wikitext text/x-wiki 9xxkukr3c4o1kjvc37eixzvitbmn1em 0 2472472 8598057 2026-09-09T19:44:40Z Armin hpj 17945789 Created page with "مکان:" 8598057 wikitext text/x-wiki 08rik122sa8o5n86f8tumo5almxkck5 8598060 8598057 2026-09-09T19:44:45Z Armin hpj 17945789 Created page with "آغاز:" 8598060 wikitext text/x-wiki 7f8bqdwq3sb4n3jofqeee7ilfauyx5s 8598062 8598060 2026-09-09T19:44:49Z Armin hpj 17945789 Created page with "پایان:" 8598062 wikitext text/x-wiki ahmhd9umerxuwzgpwiydptlfxw8tpme 8598064 8598062 2026-09-09T19:44:56Z Armin hpj 17945789 Created page with "کنفرانس قبلی:" 8598064 wikitext text/x-wiki cf9k4438ma7xj8h8hvzlh3e0u68i093 8598066 8598064 2026-09-09T19:44:59Z Armin hpj 17945789 Created page with "کنفرانس بعدی:" 8598066 wikitext text/x-wiki eeg6dnoznmon2u14aq00wcmld0hy4cp 8598068 8598066 2026-09-09T19:45:46Z Armin hpj 17945789 Created page with "'''تاریخ ها:''' ۲۵-۲۷ مارس ۲۰۲۶" 8598068 wikitext text/x-wiki buoe26l7xt3213ls5fwa7yfia8t5tol 8598070 8598068 2026-09-09T19:46:09Z Armin hpj 17945789 Created page with "۵ دقیقه" 8598070 wikitext text/x-wiki 6gtlzne1svv8dm1sped0f6dq7tra2hp 8598072 8598070 2026-09-09T19:46:20Z Armin hpj 17945789 Created page with "۱۵ دقیقه" 8598072 wikitext text/x-wiki 4ba1rytml4tpnih5tmf12hjbnokkea9 8598074 8598072 2026-09-09T19:46:33Z Armin hpj 17945789 Created page with "۱ ساعت" 8598074 wikitext text/x-wiki tuse1czy11f8vo5fhewqtkc9km4m3mo 8598076 8598074 2026-09-09T19:46:54Z Armin hpj 17945789 Created page with "۱۵ دقیقه" 8598076 wikitext text/x-wiki f1rd8e8puh93sarz6rzpp9zrk9wwgmq 8598078 8598076 2026-09-09T19:48:36Z Armin hpj 17945789 Created page with "برنز" 8598078 wikitext text/x-wiki mba7cjh0opk4h45abt0xyoyppr6qde0 8598080 8598078 2026-09-09T19:48:48Z Armin hpj 17945789 Created page with "نقره" 8598080 wikitext text/x-wiki 3hoh2q4z7aahhfyihk82l78mbeqhads 8598082 8598080 2026-09-09T19:48:51Z Armin hpj 17945789 Created page with "طلا" 8598082 wikitext text/x-wiki 59rj37n76g0z1pimm21it7buxkml3b2 8598084 8598082 2026-09-09T19:49:20Z Armin hpj 17945789 Created page with "== جستارهای وابسته ==" 8598084 wikitext text/x-wiki 8edefkbtczmc0rfdx39nx45vzn5j0yc 1198 2472473 8598058 2026-09-09T19:44:45Z Armin hpj 17945789 Created page with "آغاز:" 8598058 wikitext text/x-wiki g2c0z8fyfo6xv5w19y75nfbwqqr3gp7 1198 2472474 8598061 2026-09-09T19:44:48Z Armin hpj 17945789 Created page with "پایان:" 8598061 wikitext text/x-wiki 03bm17io8ahqb5ytr6wem5lqbs3tltk 1198 2472475 8598063 2026-09-09T19:44:55Z Armin hpj 17945789 Created page with "کنفرانس قبلی:" 8598063 wikitext text/x-wiki 9q0b8ficv2mpr9r0tglvfxif10484el 1198 2472476 8598065 2026-09-09T19:44:59Z Armin hpj 17945789 Created page with "کنفرانس بعدی:" 8598065 wikitext text/x-wiki lavzvdsxphubrosl4bakks3hbumbpg7 1198 2472477 8598067 2026-09-09T19:45:44Z Armin hpj 17945789 Created page with "'''تاریخ ها:''' ۲۵-۲۷ مارس ۲۰۲۶" 8598067 wikitext text/x-wiki 9auo1zw93besyrbn16oaaoxtt7d2nhi 1198 2472478 8598069 2026-09-09T19:46:09Z Armin hpj 17945789 Created page with "۵ دقیقه" 8598069 wikitext text/x-wiki ee361ua0h6rz6z949c0jh3mbbkn0r88 1198 2472479 8598071 2026-09-09T19:46:19Z Armin hpj 17945789 Created page with "۱۵ دقیقه" 8598071 wikitext text/x-wiki k20suc9ahaaxuxwfk4sldqz5okgoe4d 1198 2472480 8598073 2026-09-09T19:46:32Z Armin hpj 17945789 Created page with "۱ ساعت" 8598073 wikitext text/x-wiki a6scxgkjo42d8sjauvc8vey8z72g3no 1198 2472481 8598075 2026-09-09T19:46:54Z Armin hpj 17945789 Created page with "۱۵ دقیقه" 8598075 wikitext text/x-wiki k20suc9ahaaxuxwfk4sldqz5okgoe4d 1198 2472482 8598077 2026-09-09T19:48:35Z Armin hpj 17945789 Created page with "برنز" 8598077 wikitext text/x-wiki dqcrgsioe7ywvlgk9glnpenyerq0c0q 1198 2472483 8598079 2026-09-09T19:48:47Z Armin hpj 17945789 Created page with "نقره" 8598079 wikitext text/x-wiki c466b6f6wmto2kojlo2dzoj6arpfzrg 1198 2472484 8598081 2026-09-09T19:48:51Z Armin hpj 17945789 Created page with "طلا" 8598081 wikitext text/x-wiki 7amdq470mq7niy2iok8mi4gr0q4gp0t 1198 2472485 8598083 2026-09-09T19:49:19Z Armin hpj 17945789 Created page with "== جستارهای وابسته ==" 8598083 wikitext text/x-wiki ppme7qz7r5eyiivtv836o3h2pp0boe8 1198 2472486 8598085 2026-09-09T19:51:48Z Armin hpj 17945789 Created page with "مکان:" 8598085 wikitext text/x-wiki 9xxkukr3c4o1kjvc37eixzvitbmn1em 0 2472487 8598086 2026-09-09T19:51:49Z Armin hpj 17945789 Created page with "مکان:" 8598086 wikitext text/x-wiki ag422s3ax6tf23zf4ejyhrg0liwm6lt 8598088 8598086 2026-09-09T19:51:53Z Armin hpj 17945789 Created page with "آغاز:" 8598088 wikitext text/x-wiki l9a8zxiu0o5vbmq37s04jwmcu1k0hzp 8598090 8598088 2026-09-09T19:51:57Z Armin hpj 17945789 Created page with "پایان:" 8598090 wikitext text/x-wiki 642er1ymo2lgxs91vxxw6mcruerl5ad 8598092 8598090 2026-09-09T19:52:06Z Armin hpj 17945789 Created page with "تاریخ‌ها:" 8598092 wikitext text/x-wiki bra6s5oxz43cc06jlgqzvbh5e3w83ak 8598094 8598092 2026-09-09T19:52:10Z Armin hpj 17945789 Created page with "مکان:" 8598094 wikitext text/x-wiki hnu6y4u1t043esgepj7vvtc8whlj9mh 8598096 8598094 2026-09-09T19:52:14Z Armin hpj 17945789 Created page with "وبگاه:" 8598096 wikitext text/x-wiki 6dn692k0jj5txl0cqt0t8ih7n620wjl 8598098 8598096 2026-09-09T19:52:21Z Armin hpj 17945789 Created page with "نام" 8598098 wikitext text/x-wiki d01pvrblbv15yet3vskp0b6yh8jdmnk 8598100 8598098 2026-09-09T19:52:38Z Armin hpj 17945789 Created page with "=== طلا ===" 8598100 wikitext text/x-wiki 3rafui7qhvadloe5nk02wmxxxchf5mb 8598102 8598100 2026-09-09T19:52:50Z Armin hpj 17945789 Created page with "=== نقره ===" 8598102 wikitext text/x-wiki 5azi2bmvfgs9qbyis4x1aa9cwp0thh4 8598104 8598102 2026-09-09T19:53:01Z Armin hpj 17945789 Created page with "=== برنز ===" 8598104 wikitext text/x-wiki aalusg0zqwmnydeq21uj3vzueqw9fvm 8598106 8598104 2026-09-09T19:53:20Z Armin hpj 17945789 Created page with "=== برگزارکنندگان ===" 8598106 wikitext text/x-wiki hont1oo8udjxwfnrwbhlus7epcocqbv 1198 2472488 8598087 2026-09-09T19:51:52Z Armin hpj 17945789 Created page with "آغاز:" 8598087 wikitext text/x-wiki g2c0z8fyfo6xv5w19y75nfbwqqr3gp7 1198 2472489 8598089 2026-09-09T19:51:57Z Armin hpj 17945789 Created page with "پایان:" 8598089 wikitext text/x-wiki 03bm17io8ahqb5ytr6wem5lqbs3tltk 1198 2472490 8598091 2026-09-09T19:52:05Z Armin hpj 17945789 Created page with "تاریخ‌ها:" 8598091 wikitext text/x-wiki tnc8dv1n65s6dcdibgkp3ji9t20z53b 1198 2472491 8598093 2026-09-09T19:52:09Z Armin hpj 17945789 Created page with "مکان:" 8598093 wikitext text/x-wiki 9xxkukr3c4o1kjvc37eixzvitbmn1em 1198 2472492 8598095 2026-09-09T19:52:14Z Armin hpj 17945789 Created page with "وبگاه:" 8598095 wikitext text/x-wiki m3nzab6e33yvil68cjgg2id2sfsr51i 1198 2472493 8598097 2026-09-09T19:52:20Z Armin hpj 17945789 Created page with "نام" 8598097 wikitext text/x-wiki 85sfc5b3lhe28y2a6q1zaqggcob12q3 1198 2472494 8598099 2026-09-09T19:52:38Z Armin hpj 17945789 Created page with "=== طلا ===" 8598099 wikitext text/x-wiki or94ughaz999sf4mt1smnnw61ah2n5r 1198 2472495 8598101 2026-09-09T19:52:49Z Armin hpj 17945789 Created page with "=== نقره ===" 8598101 wikitext text/x-wiki herbq2k56ds51vbt305op19i3kxr115 1198 2472496 8598103 2026-09-09T19:53:01Z Armin hpj 17945789 Created page with "=== برنز ===" 8598103 wikitext text/x-wiki a9ni0b9j0ujwc2q41wljch0ajpeurml 1198 2472497 8598105 2026-09-09T19:53:20Z Armin hpj 17945789 Created page with "=== برگزارکنندگان ===" 8598105 wikitext text/x-wiki khm3tljerrovxtjahvbaubibm858j3b 1198 2472501 8598135 2026-09-09T22:07:37Z IJuulia 17387949 Created page with "MediaWiki oferece as seguintes APIs web:" 8598135 wikitext text/x-wiki mxcy3tqcs4dgt2u3qgpcwh6mskrn231 8598169 8598135 2026-09-09T22:17:25Z IJuulia 17387949 8598169 wikitext text/x-wiki 5s0mxxauczb0uaonomojxiz37wkn295 8598171 8598169 2026-09-09T22:17:54Z IJuulia 17387949 8598171 wikitext text/x-wiki mxcy3tqcs4dgt2u3qgpcwh6mskrn231 8598181 8598171 2026-09-09T22:19:04Z IJuulia 17387949 8598181 wikitext text/x-wiki 5s0mxxauczb0uaonomojxiz37wkn295 1198 2472502 8598139 2026-09-09T22:08:27Z IJuulia 17387949 Created page with "a [[$1|API de REST do MediaWiki]]" 8598139 wikitext text/x-wiki fqt17qqjo43ijb6sfsl4crxvnerq8zw 8598173 8598139 2026-09-09T22:18:21Z IJuulia 17387949 8598173 wikitext text/x-wiki ozxd70ponxopm08zegtvce90769edlf 8598183 8598173 2026-09-09T22:20:01Z IJuulia 17387949 8598183 wikitext text/x-wiki 7xwtqd1e3gvxhsws23b7jbakoshxiar 1198 2472503 8598141 2026-09-09T22:09:30Z IJuulia 17387949 Created page with "A API de Ação disponibiliza uma gama muito maior de funcionalidades, enquanto a API de REST (que é mais nova) tem URLs melhor estruturadas e executa mais rapidamente." 8598141 wikitext text/x-wiki bakx1dp7ihgbz5cxqd7xzlmaq8px9vo 8598175 8598141 2026-09-09T22:18:29Z IJuulia 17387949 8598175 wikitext text/x-wiki n94vnsdhysa1whgiis712hg3bo2niob 8598185 8598175 2026-09-09T22:20:07Z IJuulia 17387949 8598185 wikitext text/x-wiki 9wbwsm5jeb7isebggt8san4vvtnc2jf 1198 2472504 8598143 2026-09-09T22:09:57Z IJuulia 17387949 Created page with "O MediaWiki também oferece as seguintes APIs de software:" 8598143 wikitext text/x-wiki aranjon82hhn7zkojkcj2fak9z8ekdr 8598177 8598143 2026-09-09T22:18:46Z IJuulia 17387949 8598177 wikitext text/x-wiki 8tsvkkq0gjy9r0hx4cz3kqsdy68jedq 8598179 8598177 2026-09-09T22:18:57Z IJuulia 17387949 8598179 wikitext text/x-wiki mcwhp8tpttyz88azrd0hhabrodwzux2 1198 2472505 8598153 2026-09-09T22:13:28Z IJuulia 17387949 Created page with "Dentro do contexto do website do MediaWiki, a API de ação pode ser acessada por JavaScript através do API de JavaScript $2." 8598153 wikitext text/x-wiki s7kjqjn4ycoanm0oyzzixats6yvjz4j 8598187 8598153 2026-09-09T22:21:06Z IJuulia 17387949 8598187 wikitext text/x-wiki 81pgvyhylji7i1x7eo67e6n6egbiisn 8598189 8598187 2026-09-09T22:21:23Z IJuulia 17387949 8598189 wikitext text/x-wiki 5d8oq752r10m2bvvelkwbihyz6yrdv4 8598191 8598189 2026-09-09T22:21:42Z IJuulia 17387949 8598191 wikitext text/x-wiki iri8kxxsrwcsp69ki75wf1zqfaead1w 1198 2472506 8598155 2026-09-09T22:14:31Z IJuulia 17387949 Created page with "($1 para requisições entre-sites permitidas, por exemplo, entre wikis WMF.)" 8598155 wikitext text/x-wiki gharuqzcvhihlk8wc6xkoks3eybi6t1 8598193 8598155 2026-09-09T22:22:02Z IJuulia 17387949 8598193 wikitext text/x-wiki r3ekky356e1dfj9efao8usgh59douiz 1198 2472507 8598157 2026-09-09T22:15:06Z IJuulia 17387949 Created page with "== APIs para wikis da Wikimedia ==" 8598157 wikitext text/x-wiki lm1onr1ys0hct8bh4na33h6f2p6yzuw 1198 2472508 8598159 2026-09-09T22:15:21Z IJuulia 17387949 Created page with "Para informações sobre APIs disponíveis para wikis da Wikimedia, consulte $1." 8598159 wikitext text/x-wiki 5gtx8zqkqs812sf471n1ft6w7tog3by 1198 2472509 8598204 2026-09-09T22:31:59Z IJuulia 17387949 Created page with "* Um '''script de usuário''' pode ser editado pelo autor original (se estiver armazenado no namespace <code>Usuário:</code>) e por qualquer um com a permissão de usuário "$1" (normalmente apenas administradores de interface)." 8598204 wikitext text/x-wiki pstc5u61d1j6zz9pwrm8y9qro6p2nr9 8598300 8598204 2026-09-09T22:54:46Z IJuulia 17387949 8598300 wikitext text/x-wiki 7y43q3kl4e6edylf80xf5rdwhurcvlx 1198 2472510 8598206 2026-09-09T22:33:47Z IJuulia 17387949 Created page with "O código normalmente é hospedado numa subpágina da [[$1|sua página de usuário]]." 8598206 wikitext text/x-wiki 9ne3humdacq5n3mds8xyks9tzywq4ae 1198 2472511 8598208 2026-09-09T22:34:27Z IJuulia 17387949 Created page with "Exemplos incluem: $2 e [[m:en:User:Hooman/useful links.js]]." 8598208 wikitext text/x-wiki j2yaq9igjtue2sjovw4zac8ocpoh13f 1198 2472512 8598210 2026-09-09T22:36:38Z IJuulia 17387949 Created page with "Scripts de usuário são parecidos com as páginas de [[$3|JavaScript]] pessoais como $3, mas eles permitem que blocos de código isolados sejam compartilhados com outros usuários." 8598210 wikitext text/x-wiki 38npzzzefupk0ranmk5zr1cavxdemoi 8598302 8598210 2026-09-09T22:55:23Z IJuulia 17387949 8598302 wikitext text/x-wiki m3guxy72lf85k96iyckdqacfhai2f2e 1198 2472513 8598218 2026-09-09T22:40:04Z IJuulia 17387949 Created page with "Administradores de interface podem editá-los." 8598218 wikitext text/x-wiki gntzu8qhczjmb9qt7znd2ztfsqs6yr1 1198 2472514 8598220 2026-09-09T22:40:32Z IJuulia 17387949 Created page with "Consulte $2 para mais informações." 8598220 wikitext text/x-wiki tb2oz1mqso98qlft1eswwq2ifoxk6up 1198 2472515 8598224 2026-09-09T22:41:18Z IJuulia 17387949 Created page with "== Escreva seu primeiro ''script'' de usuário ==" 8598224 wikitext text/x-wiki g74vzdq8ahrzmucbc9a3apy096617a2 1198 2472516 8598226 2026-09-09T22:41:55Z IJuulia 17387949 Created page with "Nessa seção, você cria um exemplo de ''script'' de usuário que calcula o tempo de leitura estimado de uma página wiki." 8598226 wikitext text/x-wiki awsyo18geafzp1x8ceka23i5resoj1a 1198 2472517 8598228 2026-09-09T22:42:39Z IJuulia 17387949 Created page with "Certifique-se de [[$1|entrar em sua conta]]." 8598228 wikitext text/x-wiki in2mioguzp3qlrqftbyjv0ynpxi66hh 1198 2472518 8598230 2026-09-09T22:42:47Z IJuulia 17387949 Created page with "Acesse $1." 8598230 wikitext text/x-wiki hzdjg7qvdx1bhmrg1hy6766h0oiuk5n 1198 2472519 8598232 2026-09-09T22:43:37Z IJuulia 17387949 Created page with "Essa página armazenda seu [[$1|JavaScript pessoal]] que é carregado em toda visualização de página (exceto $2)." 8598232 wikitext text/x-wiki hj91b0rcnd3y9wdph85g23owty00pzr 8598310 8598232 2026-09-09T22:57:20Z IJuulia 17387949 8598310 wikitext text/x-wiki 1ml995kphvipvmifprk4hetwj05w7cw 1198 2472520 8598234 2026-09-09T22:43:59Z IJuulia 17387949 Created page with "Crie a página ou edite a página se ela já existir." 8598234 wikitext text/x-wiki iwws180yeuo9pdzwa7vjxowfvu8rtmn 1198 2472521 8598236 2026-09-09T22:44:13Z IJuulia 17387949 Created page with "Copie as seis linhas seguintes e cole-as na página:" 8598236 wikitext text/x-wiki rja561npm7xmj71cseo4bqd6n2gr71n 1198 2472522 8598238 2026-09-09T22:44:19Z IJuulia 17387949 Created page with "Clique em $1." 8598238 wikitext text/x-wiki 20czfrqzg5jpl2qzpartb9bcdva81cn 1198 2472523 8598240 2026-09-09T22:44:36Z IJuulia 17387949 Created page with "Vá para qualquer página. Observe o título." 8598240 wikitext text/x-wiki hvrks6j8co8krw6ap9xy58lhwazjnd8 1198 2472524 8598242 2026-09-09T22:44:50Z IJuulia 17387949 Created page with "Esse exemplo de ''script'' de usuário foi retirado de $1." 8598242 wikitext text/x-wiki 4dk7xry0tcqa5lvc5tqy0rju2xmddje 1198 2472525 8598244 2026-09-09T22:45:11Z IJuulia 17387949 Created page with "Há mais exemplos de ''scripts'' de usuário simples nessa página." 8598244 wikitext text/x-wiki 845mogbudsc4aet3lhd1b8tkabuet1k 1198 2472526 8598246 2026-09-09T22:45:23Z IJuulia 17387949 Created page with "== Um exemplo de ''script'' de usuário mais complexo ==" 8598246 wikitext text/x-wiki cdhhoacj04p7svfp5i6wwpa4tzsx9ud 1198 2472527 8598277 2026-09-09T22:47:10Z IJuulia 17387949 Created page with "Consulte $1 que usa $2 do ResourceLoader, a API de ação do MediaWiki, uma caixa de diálogo do ''jQuery UI'', ''jQuery AJAX'', e vínculo de eventos ''jQuery''." 8598277 wikitext text/x-wiki kc42zeb4pvqdqoyd2p04l9lure7gcm5 1198 2472528 8598279 2026-09-09T22:48:05Z IJuulia 17387949 Created page with "Copie e cole o conteúdo da página [[MediaWiki:Tutorial-QuickRC.js]] na sua [[Special:MyPage/common.js]]." 8598279 wikitext text/x-wiki 1yztiv431p4gx0wgr2xnyw4shpyxlgb 1198 2472529 8598282 2026-09-09T22:50:57Z IJuulia 17387949 Created page with "O resultado será o mesmo que o acima, mas agora você pode modificar o ''script'', brincar com ele, e trocá-lo totalmente por outra coisa." 8598282 wikitext text/x-wiki iow8qfeh0z1pdsh6n0890546y1p2iv0 1198 2472530 8598284 2026-09-09T22:52:41Z IJuulia 17387949 Created page with "Ao clicar em "Pré-visualizar" (ou usando o atalho de teclado, normalmente $1) no editor, a última versão do ''script'' será executada. Essa é uma boa maneira de navegar sem salvar a página. Lembre-se que nada é salvo até clicar em "Publicar"." 8598284 wikitext text/x-wiki k792vhhvzoi84on3jma893iujmi26sl 1198 2472531 8598286 2026-09-09T22:52:56Z IJuulia 17387949 Created page with "== Carregar um ''script'' de usuário existente ==" 8598286 wikitext text/x-wiki tiu1a7huk9cp0203edfed22pcmqkwwm 1198 2472532 8598288 2026-09-09T22:53:08Z IJuulia 17387949 Created page with "Na seção anterior, você copiou o conteúdo de um ''script'' de usuário." 8598288 wikitext text/x-wiki 0nquh9z1qxva4ctc6xlspprfua6h3rx 1198 2472533 8598290 2026-09-09T22:53:28Z IJuulia 17387949 Created page with "Nessa seção, você irá carregar o ''script'' $1 já existente." 8598290 wikitext text/x-wiki sz4apz2dj26bcgkyc6yhyolkcxle8ti 1198 2472534 8598292 2026-09-09T22:53:35Z IJuulia 17387949 Created page with "Certifique-se de [[$1|entrar em sua conta]]." 8598292 wikitext text/x-wiki in2mioguzp3qlrqftbyjv0ynpxi66hh 1198 2472535 8598294 2026-09-09T22:53:38Z IJuulia 17387949 Created page with "Acesse $1." 8598294 wikitext text/x-wiki hzdjg7qvdx1bhmrg1hy6766h0oiuk5n 1198 2472536 8598296 2026-09-09T22:53:50Z IJuulia 17387949 Created page with "Essa página armazena seu [[$1|JavaScript pessoal]] que é carregado em toda visualização de página (exceto $2)." 8598296 wikitext text/x-wiki surwkz5wmbopjwt8uru306ep2yycndn 8598312 8598296 2026-09-09T22:57:26Z IJuulia 17387949 8598312 wikitext text/x-wiki 1ml995kphvipvmifprk4hetwj05w7cw 1198 2472537 8598314 2026-09-09T22:57:33Z IJuulia 17387949 Created page with "Crie a página ou edite a página se ela já existir." 8598314 wikitext text/x-wiki iwws180yeuo9pdzwa7vjxowfvu8rtmn 1198 2472538 8598316 2026-09-09T22:57:57Z IJuulia 17387949 Created page with "Copie o seguinte texto e cole-o na página:" 8598316 wikitext text/x-wiki siemsrvn06ixpcy6yvfzzbvsaxcgbnt 1198 2472539 8598318 2026-09-09T22:58:44Z IJuulia 17387949 Created page with "Clique em "Publicar alterações". Você terá agora um ''link'' na seção de "Ferramentas" chamado "Histórico rápido"." 8598318 wikitext text/x-wiki fdv4lyu2rqa7hnil2pyvzproec5zpmq 1198 2472540 8598320 2026-09-09T22:59:06Z IJuulia 17387949 Created page with "Clique em "Histórico rápido". Você receberá uma janela ''pop-up''." 8598320 wikitext text/x-wiki 41zthx8n6oj4t5n4x6n4zet7nd2j8dw 1198 2472541 8598322 2026-09-09T23:00:04Z IJuulia 17387949 Created page with "Ela mostra um pedaço das [[$1|últimas alterações]] dessa página." 8598322 wikitext text/x-wiki s43gzy8xb44zj75b5tszu4x6o8hehn6 1198 2472542 8598324 2026-09-09T23:00:21Z IJuulia 17387949 Created page with "=== Usar um ''script'' em outra wiki da Wikimedia ===" 8598324 wikitext text/x-wiki 4ay3phsas3s20vzcmfra4slp83k9l7c 1198 2472543 8598326 2026-09-09T23:02:08Z IJuulia 17387949 Created page with "Se você quiser usar um ''script'' em outro website da Wikimedia (por exemplo, a Wikipédia em português ao invés da MediaWiki.org), você pode executar os mesmos passos anteriores: você pede ao ResourceLoader que carregue seu código. Acesse seu [[w:Special:MyPage/common.js|common.js]] na Wikipédia em português e adicione o seguinte:" 8598326 wikitext text/x-wiki g7jn8z9zfmid55vcvbapfxr4t39ua07 1198 2472544 8598328 2026-09-09T23:04:07Z IJuulia 17387949 Created page with "Você também pode carregar o ''script'' de usuário que você acabou de criar anteriormente, ao mudar <code>MediaWiki:Tutorial-QuickRC.js</code> na linha anterior para <code>Usuário:''SeuNome''/''SeuScript''.js</code> (substitua <code>''SeuNome''</code> e <code>''SeuScript''</code> de acordo)." 8598328 wikitext text/x-wiki 814m38kcr3f3xuqf65xifow58ib3axe 1198 2472545 8598330 2026-09-09T23:05:21Z IJuulia 17387949 Created page with "Esse primeiro requer que você não armazene o código de seu ''script'' de usuário na própria $1 e sim numa subpágina separada na sua [[$2|página de usuário]]." 8598330 wikitext text/x-wiki llo0d775awons4e9tmafckitnok6r14 1198 2472546 8598332 2026-09-09T23:06:17Z IJuulia 17387949 Created page with "Isso também permite [[$1|concentrar o código em um único local, para que você tenha que atualizar o código apenas em um local]]." 8598332 wikitext text/x-wiki momq4cekm0anlqldln2xh1gjiehttrd 1198 2472547 8598334 2026-09-09T23:07:31Z IJuulia 17387949 Created page with "Essa seção lista recursos que são necessários ou auxiliares para ''scripts'' de usuário mais complexos." 8598334 wikitext text/x-wiki syg4m49ejjgyday3af8j6hvd4ui54zn 1198 2472548 8598338 2026-09-09T23:10:38Z IJuulia 17387949 Created page with "$1 é um recurso principal do MediaWiki que disponibiliza ativos de JavaScript e CSS para usuários e leitores de maneira inteligente. Uma vez que ''Gadgets'' são escritos em JavaScript, como um desenvolvedor de ''Gadget'', você estará propenso a interagir com o ResourceLoader." 8598338 wikitext text/x-wiki dbpvqkmylk7jttipjfebtsydbsreu30 1198 2472549 8598340 2026-09-09T23:11:06Z IJuulia 17387949 Created page with "Seu ''gadget'' deverá carregar módulos úteis do ResourceLoader." 8598340 wikitext text/x-wiki 05dpmn2j0zya5bzhxt783zu8km6khst 1198 2472550 8598342 2026-09-09T23:12:01Z IJuulia 17387949 Created page with "* [[$modules|Módulos]] — Uma lista de bibliotecas JavaScript, plugins jQuery e utilitários do MediaWiki pré-existentes no ResourceLoader para você reutilizar." 8598342 wikitext text/x-wiki q54tql06q4zk428q4xaei0988wypy7v 1198 2472551 8598349 2026-09-09T23:13:05Z IJuulia 17387949 Created page with "'''Codex''' é o {{$2|sistema de design}} oficial para $1." 8598349 wikitext text/x-wiki d46yfhzr5u5otcg92ms2pbb2y7agdrp 1198 2472552 8598351 2026-09-09T23:15:28Z IJuulia 17387949 Created page with "Ele fornece uma gama de ferramentas unificadas, diretrizes e componentes para auxiliar programadores e designers a desenvolver interfaces de usuário consistentes, [[$1|acessíveis]] e [[$2|localizadas]] em volta dos projetos Wikimedia." 8598351 wikitext text/x-wiki ekvr6d8ce7rpfxm2u30yj8e8cj4z10d 1198 2472553 8598355 2026-09-09T23:16:34Z IJuulia 17387949 Created page with "Dentro do contexto de um website MediaWiki, a API de ação pode ser acessada por meio de JavaScript através da JavaScript API $1." 8598355 wikitext text/x-wiki m8gl1jkzlsf9qt2ena8vwp0do0ullw9 1198 2472554 8598357 2026-09-09T23:16:43Z IJuulia 17387949 Created page with "($1 para requisições entre-sites permitidas, por exemplo, entre wikis da família Wikimedia.)" 8598357 wikitext text/x-wiki r3ekky356e1dfj9efao8usgh59douiz 1198 2472555 8598359 2026-09-09T23:18:55Z IJuulia 17387949 Created page with "Se seu ''gadget'' faz requisições API diretamente, adicione o parâmetro $callback para a API URL se você estiver tentando fazer uma requisição API que violaria a [[w:same-origin-policy|política de mesma origem]] (por exemplo, ao fazer uma requisição ao Commons API da Wikipédia). Isso aciona o uso de [[w:JSONP|JSONP]] e reitera certas [[$restrict|restrições]]." 8598359 wikitext text/x-wiki lb0x3w74snxk7v85hzq1p3yim92rcta 1198 2472556 8598361 2026-09-09T23:19:30Z IJuulia 17387949 Created page with "Consulte [[VisualEditor/Gadgets]] para um tutorial especificamente para ''gadgets'' do [[VisualEditor]]." 8598361 wikitext text/x-wiki 5sncxllrtwafhoehjn90t38ckoflxj6 1198 2472557 8598363 2026-09-09T23:19:48Z IJuulia 17387949 Created page with "=== Depuração de ''scripts'' de usuário e ''gadgets'' ===" 8598363 wikitext text/x-wiki j494l9jmo9o97vb2phxx2hrtsey24us 1198 2472558 8598365 2026-09-09T23:20:09Z IJuulia 17387949 Created page with "''Gadgets'' são normalmente compactados pelo ResourceLoader, minimizados e agregados." 8598365 wikitext text/x-wiki f526gqx931bl09z4cs1ierjvntkow9f 1198 2472559 8598367 2026-09-09T23:21:12Z IJuulia 17387949 Created page with "Utilize o parâmetro URI $5 (precedido por $3 ou $4, obviamente), para requisitar a versão não-compactada da sua página e carregar a "versão original" de seu ''gadget''." 8598367 wikitext text/x-wiki tgzfxt870s7vmwp6h49asph2r59anu8 1198 2472560 8598369 2026-09-09T23:21:37Z IJuulia 17387949 Created page with "Consulte também [[$1|Desenvolvimento com o ResourceLoader]] para mais informações." 8598369 wikitext text/x-wiki qw3ok30m6na8ln51rj6qdotgka6vnif 1198 2472561 8598371 2026-09-09T23:22:05Z IJuulia 17387949 Created page with "Aprenda como usar as Ferramentas de Desenvolvedor do seu navegador (por exemplo, como desabilitar cache no seu navegador)." 8598371 wikitext text/x-wiki 2nffyoel9aov7hnme0o8ya45cguw6mf 1198 2472562 8598373 2026-09-09T23:22:46Z IJuulia 17387949 Created page with "Veja a documentação correspondente: [$1 Chrome/Chromium], [[$2|Firefox]], [$3 Internet Explorer], [$4 Opera], [$5 Safari]." 8598373 wikitext text/x-wiki bmp8e8edw75qkltsrg4fqb2aliqkbxl 1198 2472563 8598376 2026-09-09T23:23:36Z IJuulia 17387949 Created page with "Se um ''gadget'' existente tiver problemas, você também pode utilizar a página [[Especial:Gadgets]] para encontrar a localização do código-fonte de um ''gadget''." 8598376 wikitext text/x-wiki o2kpnvo1y9u89bw4if2a0c5okdviebo 1198 2472564 8598378 2026-09-09T23:23:46Z IJuulia 17387949 Created page with "=== Privacidade e conteúdo externo ===" 8598378 wikitext text/x-wiki 1awo84zpsgwxp9cttoqmp71q9afax4z 1198 2472565 8598380 2026-09-09T23:24:37Z IJuulia 17387949 Created page with "Você não deve carregar recursos externos que podem ferir a privacidade dos usuários. Nas wikis da Wikimedia, os seguintes domínios são considerados seguros:" 8598380 wikitext text/x-wiki oex1skrnk2q2tfkrat518tm7g90nvx7 1198 2472566 8598382 2026-09-09T23:26:05Z IJuulia 17387949 Created page with "''Havia'' uma tarefa do [[$1|Jenkins]] ([[$2|código]] da [$url tarefa]) que automaticamente verificava ''gadgets'' por este motivo, mas essa tarefa não têm sido executada ativamente desde 2022." 8598382 wikitext text/x-wiki h6soeq8fs07ti2pc9zko1trxnpb4gi1 1198 2472567 8598384 2026-09-09T23:26:20Z IJuulia 17387949 Created page with "=== Execução de código no carregamento de páginas ===" 8598384 wikitext text/x-wiki ckoad77tbywhjghg1zdzgl49glehmry 1198 2472568 8598386 2026-09-09T23:27:30Z IJuulia 17387949 Created page with "A tarefa comum de executar código assim que uma página é carregada tem diversas armadilhas que até mesmo editores experientes caem." 8598386 wikitext text/x-wiki pgcp7p67bgaqptg427v9ax9vh7t4k78 1198 2472569 8598388 2026-09-09T23:27:54Z IJuulia 17387949 Created page with "Primeiramente, quando seu código trabalha com elementos da DOM, execute-o no carregamento da página." 8598388 wikitext text/x-wiki j0qza5rd7jx29pr6o7qeyk7bzds0pt9 1198 2472570 8598390 2026-09-09T23:28:22Z IJuulia 17387949 Created page with "Caso contrário, seu código pode executar cedo demais." 8598390 wikitext text/x-wiki k0ub284s2k5u51xx0w4porbdnxpzufl 1198 2472571 8598392 2026-09-09T23:28:51Z IJuulia 17387949 Created page with "O jeito mais comum de fazer isso é usando a função $1 do jQuery, que faz a mesma coisa que $2." 8598392 wikitext text/x-wiki tt584hrimx6u821c1jgoh6i4u737v9q 1198 2472572 8598394 2026-09-09T23:29:17Z IJuulia 17387949 Created page with "Porém, se seu código funciona com a parte de conteúdo da página (o elemento $1), você deve usar o ''hook'' $2." 8598394 wikitext text/x-wiki ihbraxmjz8vqmuwwbniv24m4fn33dk1 1198 2472573 8598396 2026-09-09T23:30:10Z IJuulia 17387949 Created page with "Desta maneira, seu código irá reprocessar a página com sucesso quando for atualizada assicronamente e o ''hook'' for ativado novamente." 8598396 wikitext text/x-wiki k9c3u4jzclfut7i3bq2hkgoe14qzfa5 1198 2472574 8598398 2026-09-09T23:31:04Z IJuulia 17387949 Created page with "Há diversas ferramentas que fazem isso, que vão de pré-visualização de edição para atualização automática da lista de páginas vigiadas." 8598398 wikitext text/x-wiki br0ulknwn6qa8p4ozh28tshgaarnlba 1198 2472575 8598400 2026-09-09T23:32:06Z IJuulia 17387949 Created page with "Certifique-se de apenas trabalhar com os descendentes do elemento $1 que sua função manipuladora utiliza e não a página inteira." 8598400 wikitext text/x-wiki c4p5pojda3yha1j3tpolqkgpp25tu5i 1198 2472576 8598402 2026-09-09T23:32:25Z IJuulia 17387949 Created page with "Caso contrário, você pode acabar executando o mesmo código para os mesmos elementos várias vezes." 8598402 wikitext text/x-wiki cx69pcahued5mcjzcgrx5iaziluashf 1198 2472577 8598404 2026-09-09T23:32:50Z IJuulia 17387949 Created page with "Perceba que o ''hook'' $1 pode ser ativado várias vezes." 8598404 wikitext text/x-wiki pgptigosba24sww1fnrl88ld1uqvvic 1198 2472578 8598406 2026-09-09T23:33:11Z IJuulia 17387949 Created page with "Tenha cuidado com o que vem no argumento $1 da função manipuladora." 8598406 wikitext text/x-wiki qvwgqjsht6tid380dpdbdesfp03drzs 1198 2472579 8598408 2026-09-09T23:33:29Z IJuulia 17387949 Created page with "Você não deve presumir que é o elemento $1." 8598408 wikitext text/x-wiki 2pskioez6tw0ive3m6th50b70kmzssq 1198 2472580 8598410 2026-09-09T23:33:49Z IJuulia 17387949 Created page with "Pode ser uma porção pequena da página, por exemplo, quando é pré-visualizada." 8598410 wikitext text/x-wiki hlywqjihcnq74ofs2uzxbcfv6lv88vl 1198 2472581 8598412 2026-09-09T23:34:27Z IJuulia 17387949 Created page with "Código que trabalha com o conteúdo da página e evita as armadilhas previamente mencionadas se parecem com isso:" 8598412 wikitext text/x-wiki 325ut40rzd8bfanbv6j9cq6s68ld8rm 1198 2472582 8598414 2026-09-09T23:34:34Z IJuulia 17387949 Created page with "Faça as coisas com $target" 8598414 wikitext text/x-wiki 44f01qfogut02t2jd7c547fgu00fthn 1198 2472583 8598416 2026-09-09T23:35:02Z IJuulia 17387949 Created page with "Apenas execute algumas operações quando for #mw-content-text em um argumento" 8598416 wikitext text/x-wiki h3vz52mjl1fqkwdezn1pokfu44u4sc7 1198 2472584 8598418 2026-09-09T23:38:37Z IJuulia 17387949 Created page with "Se seu código trabalha com o conteúdo da página e adiciona manipuladores de evento aos elementos da DOM, ao invés de usar hooks em $1 e buscar por elementos para anexar ouvintes de eventos (''event listeners'') à ele ao ser ativado, você pode usar ''delegação de evento'': anexe um ouviente de evento a um elemento fora da área de conteúdo ou o $2 inteiro mas filtre eventos por um seletor (consulte a [$3 documentação do jQuery])." 8598418 wikitext text/x-wiki qm83ppcx5p80vzcsxnp0itk3p7rvseo 1198 2472585 8598420 2026-09-09T23:38:50Z IJuulia 17387949 Created page with "Isto é, ao invés de escrever $1, você pode escrever $2." 8598420 wikitext text/x-wiki e02cmf2mxal5lhsu55d7kaujs45a7sw 1198 2472586 8598422 2026-09-09T23:39:04Z IJuulia 17387949 Created page with "=== Métricas de gravação ===" 8598422 wikitext text/x-wiki 6il8zw0x8djo1jgy4z3hquljiu6iyod 1198 2472587 8598424 2026-09-09T23:39:26Z IJuulia 17387949 Created page with "Alguns ''gadgets'' são negócios sérios." 8598424 wikitext text/x-wiki g6z4mozpp2r9qj2cksqu8neloarzpkw 1198 2472588 8598426 2026-09-09T23:40:37Z IJuulia 17387949 Created page with "Quando seu ''gadget'' fica sério, você pode querer utilizá-lo como instrumento para propósitos analíticos, por exemplo, para medir a taxa de cliques de elementos específicos da UI adicionados em uma página pelo ''gadget''." 8598426 wikitext text/x-wiki q4c9wr3hafvvq4cpqshi75o1o94piqp 1198 2472589 8598428 2026-09-09T23:40:51Z IJuulia 17387949 Created page with "=== Diversos ===" 8598428 wikitext text/x-wiki lov0ru6h95sqs43xp8hrzmzfxv3b1oh 1198 2472590 8598430 2026-09-09T23:41:49Z IJuulia 17387949 Created page with "Código de ''gadget'' não precisa seguir [[$jsconv|as convenções de código JavaScript]] para MediaWiki, mas se você espera que outros mexam no seu código, elas podem ser usadas como referência." 8598430 wikitext text/x-wiki hv6ky8jjamzkkfm6p21pljk4wc9x9yp 1198 2472591 8598432 2026-09-09T23:43:36Z IJuulia 17387949 Created page with "Se você estiver desenvolvendo em uma [[w:pt:IDE]] como o [[w:pt:VS Code]], você pode usar definições de tipo para [https://www.npmjs.com/package/types-mediawiki MediaWiki], [https://www.npmjs.com/package/@types/oojs OOjs], [https://www.npmjs.com/package/@types/oojs-ui OOUI], e [https://www.npmjs.com/package/@types/jquery jQuery] para [[w:Code completion|preenchimento automático de código]] e [[w:type checking|checagem de tipo]]." 8598432 wikitext text/x-wiki kt6aewuwmwglvyudu3z899t127lz3y6 1198 2472592 8598434 2026-09-09T23:43:48Z IJuulia 17387949 Created page with "== Desvantagens e problemas de ''gadgets'' ==" 8598434 wikitext text/x-wiki bspfes64ff9g9agbcrlpbbajgwsuiao 1198 2472593 8598436 2026-09-09T23:44:03Z IJuulia 17387949 Created page with "''Gadgets'' são desenvolvidos por membros da comunidade." 8598436 wikitext text/x-wiki p9euji5hbv0tq8i96v17plig57t80to 1198 2472594 8598438 2026-09-09T23:44:39Z IJuulia 17387949 Created page with "Até hoje, não é necessário que haja revisão formal de código para ''gadgets'' nos sites da Wikimedia (veja $1)." 8598438 wikitext text/x-wiki cqs1648mq040pzrmgfzwdyvlbwbtjiy 1198 2472595 8598440 2026-09-09T23:45:01Z IJuulia 17387949 Created page with "Por favor, siga as boas práticas listadas nessa página." 8598440 wikitext text/x-wiki p9cvf0ugzw5iqj8zr5t3mbaw6cj6anw 1198 2472596 8598442 2026-09-09T23:45:55Z IJuulia 17387949 Created page with "Em sites Wikimedia, o processo de "promover" um ''script'' de usuário para um ''gadget'' na seção de [[$1|"''Gadgets''"]] nas preferências de usuário não é sempre clara." 8598442 wikitext text/x-wiki kycmyfwy7sx2sl6l2sqf2l42g812h61 1198 2472597 8598444 2026-09-09T23:46:50Z IJuulia 17387949 Created page with "Você terá que encontrar um [[$1|administrador de interface]] e talvez tenha que fornecer instruções de ''deploy'' para ele." 8598444 wikitext text/x-wiki 7ha6l5ejh9weoru4s8b37m6t0aa35kx 1198 2472598 8598446 2026-09-09T23:47:26Z IJuulia 17387949 Created page with "A Wikimedia não possui um processo sistemático para reutilização, modificação e contribuição de ''scripts'' de usuário e ''gadgets'' pré-existentes." 8598446 wikitext text/x-wiki jufeli82chi03bxl68hkq9wbtytymen 1198 2472599 8598448 2026-09-09T23:47:44Z IJuulia 17387949 Created page with "== Sugestões de trabalho ==" 8598448 wikitext text/x-wiki 0ds418u7l113obei6wjius2c3z33k3o 1198 2472600 8598450 2026-09-09T23:48:12Z IJuulia 17387949 Created page with "Alguns membros da comunidade da Wikimedia podem comparitlhar suas ideias e o que eles gostariam de ver implementados por outras pessoas." 8598450 wikitext text/x-wiki nu0wk5syyl00azhmyvbz7v3zl8pvoqv 1198 2472601 8598452 2026-09-09T23:48:30Z IJuulia 17387949 Created page with "Você pode fazer pequenos arranjos em ''gadgets'' existentes, ou trabalhar em propostas" 8598452 wikitext text/x-wiki mhe9sma71rcnimkumd8h7dgihk0qkdt 1198 2472602 8598454 2026-09-09T23:48:46Z IJuulia 17387949 Created page with "não é uma página popular, então pode ser que você perca tempo" 8598454 wikitext text/x-wiki 8yygqyswwzh47c4qu6pxs8s6i9kemw4 1198 2472603 8598456 2026-09-09T23:49:04Z IJuulia 17387949 Created page with "[[w:Wikipedia:User scripts/Requests|Pedidos]]" 8598456 wikitext text/x-wiki 0pgd5mz0ia9uw0h72jucjvwbegvzkab 1198 2472604 8598458 2026-09-09T23:49:15Z IJuulia 17387949 Created page with "para a Wikipédia em inglês" 8598458 wikitext text/x-wiki 4ythlfkv7kegfxf5lq7wbzl03mqlhuj 1198 2472605 8598460 2026-09-09T23:49:38Z IJuulia 17387949 Created page with "== Fazendo ''deploy'' ou ativando um ''gadget'' ==" 8598460 wikitext text/x-wiki jrn23htxbixb46txp0oydlj7prpcv88 1198 2472606 8598462 2026-09-09T23:50:19Z IJuulia 17387949 Created page with "Se seu ''script'' de usuário deveria virar um ''gadget'' (veja as [[$1|definições]] acima) em uma wiki, os seguintes passos são necessários:" 8598462 wikitext text/x-wiki 3mz47oxid512hsfm5n3ntryia3r28xh 1198 2472607 8598464 2026-09-09T23:50:28Z IJuulia 17387949 Created page with "Passos para o autor do ''script'':" 8598464 wikitext text/x-wiki s46suen5szz19193c7ezvmn3x1cansr 1198 2472608 8598466 2026-09-09T23:50:49Z IJuulia 17387949 Created page with "Recrute um desenvolvedor experiente para revisar seu código." 8598466 wikitext text/x-wiki 7zj6aynpq84p1xweoo707omqf8dn0y7 1198 2472609 8598468 2026-09-09T23:50:57Z IJuulia 17387949 Created page with "Não há processo formal para fazer isso." 8598468 wikitext text/x-wiki d5g894n8wnyz9pbbe4xoon2dq0qt6iu 1198 2472610 8598470 2026-09-09T23:51:28Z IJuulia 17387949 Created page with "Verifique com membros da comunidade se não há nenhum problema com ativar o ''gadget'' em uma wiki" 8598470 wikitext text/x-wiki rn790vt3f60gv4b6tw4lxo7pkh87kq2 8598472 8598470 2026-09-09T23:51:33Z IJuulia 17387949 8598472 wikitext text/x-wiki ka4xsf2vb9vsde5ew9wqgak0v4cby3y 1198 2472611 8598474 2026-09-09T23:52:02Z IJuulia 17387949 Created page with "Para o próprio website MediaWiki.org, isso seria [[Project:Village Pump]]." 8598474 wikitext text/x-wiki 506tf0ok9gbahkm645jzi9wcatvgr0s 1198 2472612 8598476 2026-09-09T23:52:27Z IJuulia 17387949 Created page with "Recrute um administrador do site com permissões de interface. Consulte a página $1 na sua wiki." 8598476 wikitext text/x-wiki rt9wye6glmdp31opaw6goa8zymxmkfc 1198 2472613 8598478 2026-09-09T23:52:39Z IJuulia 17387949 Created page with "Passos para o administrador de interface:" 8598478 wikitext text/x-wiki kjm8shusgmp4nzd9a7adykuf9tfpwt2 1198 2472614 8598480 2026-09-09T23:53:32Z IJuulia 17387949 Created page with "Copie seus arquivos JS e CSS no [[$2|namespace]] $1 na sua wiki, e certifique-se que os nomes das páginas têm o prefixo $3." 8598480 wikitext text/x-wiki 4sr0d1q0eyn2kxwne7nxcrjkoejmjka 1198 2472615 8598482 2026-09-09T23:53:37Z IJuulia 17387949 Created page with "''Exemplo:''" 8598482 wikitext text/x-wiki 2jejt8ux2o1b0ozl12oy5820s9amt7u 1198 2472616 8598484 2026-09-09T23:53:49Z IJuulia 17387949 Created page with "Defina o ''gadget'' na página $1 da sua wiki." 8598484 wikitext text/x-wiki 02k86ftlzuhc8cl5cng9bzi4gmmubma 1198 2472617 8598486 2026-09-09T23:54:10Z IJuulia 17387949 Created page with "Isso inclui os módulos utilizados, dependências, nomes dos arquivos JS e CSS, etc." 8598486 wikitext text/x-wiki jv6gedguk0l5s69mw9p52v2gsubzfdb 1198 2472618 8598488 2026-09-09T23:54:31Z IJuulia 17387949 Created page with "Isso permitirá que usuários ativem o ''gadget'' na sua página $1 da sua wiki." 8598488 wikitext text/x-wiki 9vjk8i4ub7j9ghevl5vl6zbft8qt72o 1198 2472619 8598490 2026-09-09T23:54:41Z IJuulia 17387949 Created page with "''Exemplo:''" 8598490 wikitext text/x-wiki 2jejt8ux2o1b0ozl12oy5820s9amt7u 1198 2472620 8598492 2026-09-09T23:54:49Z IJuulia 17387949 Created page with "Crie uma página para o ''gadget'' na namespace $1 com o prefixo $2." 8598492 wikitext text/x-wiki hs0sb01z81nftg82ux0wz6b05y8x765 1198 2472621 8598494 2026-09-09T23:55:02Z IJuulia 17387949 Created page with "Isso gerará uma etiqueta para o ''gadget'' na página $1 de sua wiki." 8598494 wikitext text/x-wiki asgzvsv0c58577dsicnhi1qmsye59w3 1198 2472622 8598496 2026-09-09T23:55:06Z IJuulia 17387949 Created page with "''Exemplo:''" 8598496 wikitext text/x-wiki 2jejt8ux2o1b0ozl12oy5820s9amt7u 1198 2472623 8598498 2026-09-09T23:55:19Z IJuulia 17387949 Created page with "== Contribuindo em ''scripts'' de usuário ==" 8598498 wikitext text/x-wiki 30lc401i002elp4vg9461j8htnfs6or 1198 2472624 8598500 2026-09-09T23:56:04Z IJuulia 17387949 Created page with "Se um ''script'' de usuário for feito por outro usuário, você deverá ter a possibilidade de contribuir nele." 8598500 wikitext text/x-wiki 5lxg3zobttiddc0vviy02tjqtezy95j 1198 2472625 8598502 2026-09-09T23:56:29Z IJuulia 17387949 Created page with "Você pode fazer isso criando uma cópia do ''script'' de usuário como uma subpágina da sua própria página de usuário." 8598502 wikitext text/x-wiki 959i82yqvwgu7ho9unnfeqoftvc0352 1198 2472626 8598504 2026-09-09T23:57:02Z IJuulia 17387949 Created page with "Então, substitua o ''script'' de usuário original que você tinha ativo com o que é uma página de usuário em seu $1." 8598504 wikitext text/x-wiki icwnb5chg86bhimohhenc0strtcu6jt 1198 2472627 8598506 2026-09-09T23:57:27Z IJuulia 17387949 Created page with "Prossiga a fazer edições de sua preferência na sua cópia de código do ''script''." 8598506 wikitext text/x-wiki ct1mz8fs7rwd288xdvrmsl09fcqxgr2 1198 2472628 8598508 2026-09-09T23:59:16Z IJuulia 17387949 Created page with "Se você quiser que o ''script'' contenha as mudanças que você fez na sua cópia do ''script'', você deveria pingar o autor do ''script'' na página de discussão do ''script'' original com a página que contém suas mudanças e pedir à ele que implemente as mudanças." 8598508 wikitext text/x-wiki n1gtlkiezwi2qs1jzx9rcv1c8falpct 1198 2472629 8598510 2026-09-09T23:59:57Z IJuulia 17387949 Created page with "Se o usuário não estiver mais ativo, então você deveria notificar a comunidade da sua versão do ''script'' linkando o ''script'' na lista de ''scripts'' da sua wiki." 8598510 wikitext text/x-wiki jlr9rcrdo6z1z91dk35grr23mrh587i 1198 2472630 8598512 2026-09-10T00:00:03Z IJuulia 17387949 Created page with "== Páginas relacionadas ==" 8598512 wikitext text/x-wiki rv79h1pmz3wce2ugvaha0w7zyrxvxjc 0 2472636 8598636 2026-09-10T08:58:33Z Nirmos 326917 Redirected page to [[Manual:User group CSS and JavaScript]] 8598636 wikitext text/x-wiki aufct3zrm9gjt7zr5zlucmrkwmiyia5 0 2472637 8598639 2026-09-10T09:00:22Z Nirmos 326917 Redirected page to [[Manual:User group CSS and JavaScript]] 8598639 wikitext text/x-wiki aufct3zrm9gjt7zr5zlucmrkwmiyia5 1198 2472638 8598642 2026-09-10T09:01:38Z HanV 6324917 Created page with "Een app voor Android-devices om foto's te uploaden naar [[$1|Wikimedia Commons]]" 8598642 wikitext text/x-wiki 1v59tqcmhm9zk37dpe91j9hkbjvowx2 1198 2472639 8598644 2026-09-10T09:01:43Z HanV 6324917 Created page with "[$dash Wiki Education Dashboard]" 8598644 wikitext text/x-wiki eg40bhsy9gns6ibx4gr0own6x7k1iis 1198 2472640 8598647 2026-09-10T09:02:06Z HanV 6324917 Created page with "Een webapplicatie die Wikipedia-onderwijsopdrachten ondersteunt, het biedt gegevens en cursusbeheer voor docenten en studenten" 8598647 wikitext text/x-wiki q50rw0ljl7v3dewqimqp591h8djss3v 1198 2472641 8598649 2026-09-10T09:02:32Z HanV 6324917 Created page with "Een 'Python'-bibliotheek en een verzameling scripts die werk automatiseren op MediaWiki-sites." 8598649 wikitext text/x-wiki 0siq6ql6x7ngufbz27in1nbmxn1hsyx 8598672 8598649 2026-09-10T09:08:34Z HanV 6324917 8598672 wikitext text/x-wiki 58j0alnlinpl71jlcayn55dcuhep77k 1198 2472642 8598651 2026-09-10T09:02:35Z HanV 6324917 Created page with "Mentor(en):" 8598651 wikitext text/x-wiki 420nn85jdnw0y5b33u1xp0v4m9pqexn 1198 2472643 8598653 2026-09-10T09:02:41Z HanV 6324917 Created page with "Schrijver" 8598653 wikitext text/x-wiki 7hcm4pnraeir42z1tv3dh5uva4ag84g 8598655 8598653 2026-09-10T09:03:15Z HanV 6324917 8598655 wikitext text/x-wiki mpxdwkvjs9pznwlwsvnarnrg6n0eq9e 1198 2472644 8598657 2026-09-10T09:04:25Z HanV 6324917 Created page with "[$1 Scribe] biedt Wikidata-gebaseerde toetsenborden voor leerlingen van een tweede taal. De functies zijn onder meer vertaling, werkwoordsvervoeging en zelfstandig naamwoord-geslacht annotatie. Dit project is zeer open voor iedereen die de benodigde talen wil leren en hoe hij met Wikidata kan werken!" 8598657 wikitext text/x-wiki meutilw1e0o8a8hwqylm3p7cseqc0rj 1198 2472645 8598659 2026-09-10T09:04:49Z HanV 6324917 Created page with "Vereiste vaardigheden: [$1 Swift] voor [$2 Scribe-iOS]; [$3 Kotlin] voor [$4 Scribe-Android]; [$5 Python] en/of [$6 Wikidata Query Service] voor onze [$7 Scribe-Data taal data-extractie CLI]" 8598659 wikitext text/x-wiki o5qm015nzx8blukysiolu14u0m59gqf 1198 2472646 8598662 2026-09-10T09:04:59Z HanV 6324917 Created page with "Mentor: [[$1|Andrew McAllister]]" 8598662 wikitext text/x-wiki ku1b5uosdstppav9qnhawpj9dhtw7s6 1198 2472647 8598664 2026-09-10T09:05:02Z HanV 6324917 Created page with "Mentor(en):" 8598664 wikitext text/x-wiki 420nn85jdnw0y5b33u1xp0v4m9pqexn 1198 2472648 8598666 2026-09-10T09:05:41Z HanV 6324917 Created page with "De webbrowser-extensie Lingua Libre SignIt vertaalt geselecteerd geschreven woord via een elegante pop-up zodat u gebarentaal leert terwijl u online leest." 8598666 wikitext text/x-wiki p7cvwguzrmlbz4n0e8sjzm4e18n3juc 1198 2472649 8598668 2026-09-10T09:06:31Z HanV 6324917 Created page with "U kunt een ondertekende video toevoegen met $1 door een taal te selecteren en vervolgens zelf een video op te nemen tijdens het ondertekenen." 8598668 wikitext text/x-wiki 7jeyft61b5gl01h5gy4mzhw9jvzdszd 1198 2472650 8598670 2026-09-10T09:06:35Z HanV 6324917 Created page with "Mentor(en):" 8598670 wikitext text/x-wiki 420nn85jdnw0y5b33u1xp0v4m9pqexn 1198 2472651 8598674 2026-09-10T09:09:26Z HanV 6324917 Created page with "''Bent u een maintainer en wilt u dat uw project in de bovenstaande lijst van softwareprojecten wordt opgenomen? [[$1|Lees meer!]]''" 8598674 wikitext text/x-wiki bqij82qoruy0svi06k8uekgb8hers12 1198 2472652 8598691 2026-09-10T09:10:50Z HanV 6324917 Created page with "== Outreach-programma's en losse taken ==" 8598691 wikitext text/x-wiki pb480bv0zyg1rbbjmesauqowc7sjv16 1198 2472653 8598704 2026-09-10T09:10:58Z HanV 6324917 Created page with "Naast de bovenstaande aanbevolen softwareprojecten zijn er meer manieren om een project of taak te kiezen om aan te werken:" 8598704 wikitext text/x-wiki p6rav1xlaefok8l9rpp9a6mgtgz826r 1198 2472654 8598706 2026-09-10T09:11:07Z HanV 6324917 Created page with "[[$1|Outreach programma's]]" 8598706 wikitext text/x-wiki j6uywrroe4yqrfowlad7kw6g50bspph 1198 2472655 8598710 2026-09-10T09:11:42Z HanV 6324917 Created page with "Wikimedia biedt stages aan in programma's zoals "Google Summer of Code" en "Outreachy"." 8598710 wikitext text/x-wiki ohnwivwiknfm2bv5qhmff3tnf95oyb9 1198 2472656 8598714 2026-09-10T09:12:36Z HanV 6324917 Created page with "Verplaatst naar wfGetDB" 8598714 wikitext text/x-wiki q0kyg7ivg3exd9bu06mxlo59hbwe07m 1198 2472657 8598718 2026-09-10T09:12:53Z HanV 6324917 Created page with "Experimentele ondersteuning voor een hulpknop "Vraag"." 8598718 wikitext text/x-wiki 1rd35mh73002mm3ht1cix3rrwuiofu2 1198 2472658 8598724 2026-09-10T09:13:11Z HanV 6324917 Created page with "Misschien verandert het later in een "hook"." 8598724 wikitext text/x-wiki 1xwrha33ex4d5xhv5bqepoizj4smcif 1198 2472659 8598730 2026-09-10T09:13:51Z HanV 6324917 Created page with "Dit is een array met de keys page, URL en params." 8598730 wikitext text/x-wiki 8gc9nkmgfaot9xlwkc0bpmomvod4gdv 8598736 8598730 2026-09-10T09:14:27Z HanV 6324917 8598736 wikitext text/x-wiki lj6z9o2rzb51paav1jv641ezacf798y 1198 2472660 8598732 2026-09-10T09:14:09Z HanV 6324917 Created page with ""page" is een titel van een lokale wiki-pagina" 8598732 wikitext text/x-wiki tsdln091xmm723mycg7q2kjzs57j1ur 1198 2472661 8598740 2026-09-10T09:15:09Z HanV 6324917 Created page with ""url" is een URL om te gebruiken zoals is (bijvoorbeeld een probleemtracker indien-formulier) die de pagina zal overschrijven indien ingesteld" 8598740 wikitext text/x-wiki kagji4kx76bbmxkfp9xzhzbfzbjx5fy 1198 2472662 8598742 2026-09-10T09:16:03Z HanV 6324917 Created page with ""params" is een array van sleutel-waardeparen van meegegeven parameters" 8598742 wikitext text/x-wiki f87xi41qwwa7oglf4qykqrr8pmjvdxg 1198 2472663 8598744 2026-09-10T09:16:17Z HanV 6324917 Created page with "elke parameterwaarde kan de variabele $1 bevatten die wordt vervangen door de volledige pagina-naam." 8598744 wikitext text/x-wiki 4mowqrr7q11f7laenswcpj7joia0wrz 1198 2472664 8598746 2026-09-10T09:16:32Z HanV 6324917 Created page with "Als $1, maar voor een specifieke namespace." 8598746 wikitext text/x-wiki rrw5hxcq24wimasqf5skpl62m3e0ah1 1198 2472665 8598748 2026-09-10T09:17:10Z HanV 6324917 Created page with "Elk $2-achtig array moet de waarde zijn die wordt toegewezen aan de numerieke ID van een namespace van de wiki." 8598748 wikitext text/x-wiki iy21emnzrwuwklwp5b5vo2a7eapmyeo 1198 2472666 8598752 2026-09-10T09:17:29Z Yushu-kasai 17795004 Translated into ja 8598752 wikitext text/x-wiki nw17m9sh3oitedqwvrfwxtrk5abr3tw 1198 2472667 8598754 2026-09-10T09:17:30Z Yushu-kasai 17795004 Translated into ja 8598754 wikitext text/x-wiki jptc278oyadd4cipapemj3wd0ptfrs4 1198 2472668 8598756 2026-09-10T09:17:32Z Yushu-kasai 17795004 Translated into ja 8598756 wikitext text/x-wiki 2kadgkoufok6hjjlbwo5rk4rs7vw3r9 8598790 8598756 2026-09-10T09:23:55Z Yushu-kasai 17795004 Proofread 8598790 wikitext text/x-wiki 2vbthra4cb797zovdix4o6e71q23uqw 1198 2472669 8598758 2026-09-10T09:17:34Z Yushu-kasai 17795004 Translated into ja 8598758 wikitext text/x-wiki lhf82llfun9782pb0sxlpnrrsloqnej 1198 2472670 8598760 2026-09-10T09:17:39Z Yushu-kasai 17795004 Translated into ja 8598760 wikitext text/x-wiki q1u42qozjb5lxek33iq6krl4vcyjeo2 1198 2472671 8598762 2026-09-10T09:17:42Z Yushu-kasai 17795004 Translated into ja 8598762 wikitext text/x-wiki g8mrb3i4tap7kfjdvhmcubwtjidvoau 1198 2472672 8598764 2026-09-10T09:17:44Z Yushu-kasai 17795004 Translated into ja 8598764 wikitext text/x-wiki qfr3gyjhupitrypyjb3s6dcn6d18jk2 1198 2472673 8598770 2026-09-10T09:19:30Z HanV 6324917 Created page with "Wanneer niet-geprivilegeerde gebruikers een vertalingseditor openen, zien zij een bericht waarin staat dat er een speciale toestemming nodig is voor het vertalen van berichten. Als deze variabele wordt gedefinieerd, is er een knop die de gebruiker naar die pagina brengt om toestemming te vragen." 8598770 wikitext text/x-wiki 0lkladzilv78uml3oo8xad93alplev6 1198 2472674 8598772 2026-09-10T09:20:09Z HanV 6324917 Created page with "Het doel moet worden herhaald met de tweede variabele om hetzelfde resultaat te krijgen met de zandbak geactiveerd waar gebruikers de zandbak niet kunnen betreden." 8598772 wikitext text/x-wiki sq5eg0k2aihz15wqksstemzmfojofzh 1198 2472675 8598778 2026-09-10T09:21:09Z HanV 6324917 Created page with "Indien ingesteld, geeft het een waarschuwing weer en laat het de gebruiker niet toe om vertaalbare pagina's met meer subpagina's dan deze waarde te verplaatsen" 8598778 wikitext text/x-wiki giu4gu3wxs7dpdebal42qlxe42tteni 1198 2472676 8598782 2026-09-10T09:21:44Z HanV 6324917 Created page with "De pagina vertaalfunctie inschakelen." 8598782 wikitext text/x-wiki e012kechlrm43l7wl992un64hqiqm1h 1198 2472677 8598784 2026-09-10T09:23:13Z HanV 6324917 Created page with "De functie paginavertaling maakt gestructureerde vertaling van wiki-pagina's met eenvoudige markering mogelijk met het automatisch volgen van wijzigingen." 8598784 wikitext text/x-wiki fdoo91yrhbnh905nsmuqp4pieshkw7l 1198 2472678 8598786 2026-09-10T09:23:37Z HanV 6324917 Created page with "Nummer voor de namespace Translations." 8598786 wikitext text/x-wiki 3ngwdg30a6egb8w0rn8ax9kad7be5c8 1198 2472679 8598788 2026-09-10T09:23:47Z HanV 6324917 Created page with "Wijzig dit als het in conflict komt met andere namespaces in uw wiki." 8598788 wikitext text/x-wiki 7kj6gtijrhf009ycm06o4lxp7f0mnc1 13 2472680 8598792 2026-09-10T09:28:20Z Wladek92 887141 /* help hebrew translators: how many plural forms 3? 4? */ new section 8598792 wikitext text/x-wiki 2i1viqwlc5ejf16efo7tceg4ezn0nhf 1198 2472684 8598820 2026-09-10T11:20:11Z Dyolf77 (WMF) 17171605 Created page with "إذا لم يكن هناك مخطط موجود يناسب احتياجاتكم، يمكنكم إنشاء صفحة جديدة وإضافة الترميز المطلوب بنفسكم." 8598820 wikitext text/x-wiki f5o35j4sl3uoplccjo5jcp4bzfe749j 1198 2472685 8598822 2026-09-10T11:20:54Z Dyolf77 (WMF) 17171605 Created page with "ستحتاجون إلى تحديد عنصر ويكي بيانات الصحيح لنوع المقالة الذي تريدون دعمه، فهذا يخبر الميزة متى تعرض المخطط الخاص بكم." 8598822 wikitext text/x-wiki 751726112n1i5tkzco0jhsylf0rp9f7 1198 2472686 8598824 2026-09-10T11:21:19Z Dyolf77 (WMF) 17171605 Created page with "الاطلاع على {{$1|دليل الترميز}} للحصول على المرجع الكامل للترميز." 8598824 wikitext text/x-wiki fye5vpaknijmf2whfyp16646ey940c0 1198 2472687 8598826 2026-09-10T11:21:32Z Dyolf77 (WMF) 17171605 Created page with "يعرض الفيديو أدناه العملية خطوة بخطوة لإنشاء مخطط." 8598826 wikitext text/x-wiki 5dyng8n0dd4v8g1hesac10yfehxfptl 1198 2472688 8598828 2026-09-10T11:21:53Z Dyolf77 (WMF) 17171605 Created page with "هذا الفيديو يوضح كيفية إنشاء مخططات لميزة إرشاد المقالات" 8598828 wikitext text/x-wiki mjfv1kye40ih8wx2fhtkxijqtks67y0 1198 2472689 8598830 2026-09-10T11:22:07Z Dyolf77 (WMF) 17171605 Created page with "=== دليل الترميز ===" 8598830 wikitext text/x-wiki 1z7i6pvkdvxvjk7bq1q0vv7dso8jbow 1198 2472690 8598832 2026-09-10T11:22:17Z Dyolf77 (WMF) 17171605 Created page with "يستخدم كل مخطط مجموعة محددة من الوسوم." 8598832 wikitext text/x-wiki 461hokgggw5jd85ombl84khe2s3jfkc 1198 2472691 8598834 2026-09-10T11:22:37Z Dyolf77 (WMF) 17171605 Created page with "يُطلب من المحررين الإبقاء على الوسوم دون تغيير وتعديل النص الموجود داخلها فقط." 8598834 wikitext text/x-wiki n0kb0w063kkroiv192h12fy5wlwa5yq 1198 2472692 8598836 2026-09-10T11:22:49Z Dyolf77 (WMF) 17171605 Created page with "فيما يلي الترميزات التي يجب تضمينها في المخطط:" 8598836 wikitext text/x-wiki 1jwzcqm65vziexe4rabznaapkmcsq81 1198 2472693 8598838 2026-09-10T11:23:08Z Dyolf77 (WMF) 17171605 Created page with "=== المخططات الموجودة ===" 8598838 wikitext text/x-wiki 1v7gg96xzmy0xk2v7v4gfelwxjep74w 1198 2472694 8598840 2026-09-10T11:23:59Z Dyolf77 (WMF) 17171605 Created page with "انظروا [[$1|صفحة إرشاد المقالات]]." 8598840 wikitext text/x-wiki lhirdpgw1k33mvdi0ce63doawbv9vdu 1198 2472695 8598842 2026-09-10T11:24:04Z Dyolf77 (WMF) 17171605 Created page with "=== عناصر ويكي بيانات ===" 8598842 wikitext text/x-wiki 5tbgicmhemozia2ovy8hgwzqvel520v 1198 2472696 8598844 2026-09-10T11:24:55Z Dyolf77 (WMF) 17171605 Created page with "للقائمة الرئيسية وعناصر ويكي بيانات التي يتصل بها كل مخطط، تفضلوا بزيارة [[$1|عنصر ويكي بيانات]] هذا." 8598844 wikitext text/x-wiki goh1owk60rucbpdgvgqgv541ionoj43 1198 2472697 8598846 2026-09-10T11:25:09Z Dyolf77 (WMF) 17171605 Created page with "== الأسئلة الشائعة حول المخططات ==" 8598846 wikitext text/x-wiki n8rj8x13i8x54dqzcgaq87eoc1aqy36 1198 2472698 8598848 2026-09-10T11:25:26Z Dyolf77 (WMF) 17171605 Created page with "هل أحتاج إلى إذن من الفريق الذي طوّر الميزة لإنشاء أو تعديل مخطط؟" 8598848 wikitext text/x-wiki l8s3e2yznoqrx0kwyue3yz7d5ml0dsj 1198 2472699 8598850 2026-09-10T11:26:11Z Dyolf77 (WMF) 17171605 Created page with "لا. المخططات هي صفحات ويكي عادية، وأي مساهم لديه الصلاحيات العادية لإنشاء أو تعديل الصفحات في مشروع ويكيبيديا يمكنه إنشاء مخطط أو تحسينه." 8598850 wikitext text/x-wiki n1bh0r6xanqnwtrfa7fqgr6b7zj5jwf 1198 2472700 8598852 2026-09-10T11:26:26Z Dyolf77 (WMF) 17171605 Created page with "ماذا لو لم يكن هناك نوع مقالة في الميزة يطابق ما أريد كتابته؟" 8598852 wikitext text/x-wiki afhd6l2zkb8jk6u5tkdq36k79aws3sw 1198 2472701 8598854 2026-09-10T11:27:14Z Dyolf77 (WMF) 17171605 Created page with "يمكنكم إنشاء مخطط جديد لذلك النوع إذا كان لديكم فهم جيد للممارسات والسياسات المطبقة على ذلك النوع من المقالات في مشروع ويكيبيديا الخاص بكم." 8598854 wikitext text/x-wiki 61iqu0g3rc0jt8piqgqn5cahahufx0c 1198 2472702 8598856 2026-09-10T11:29:57Z Dyolf77 (WMF) 17171605 Created page with "أولاً، ابحثوا عن[[$1|عنصر ويكي بيانات]] المطابق أو أنشؤوه، ثم انشؤوا المخطط باتباع التعليمات الخاصة بإنشاء مخطط." 8598856 wikitext text/x-wiki 8qdqtbcthvyfg6u14urtzbcz5vi1jpr 1198 2472703 8598858 2026-09-10T11:30:48Z Dyolf77 (WMF) 17171605 Created page with "إلى أن يوجد مخطط، سيرى المحررون رسالة «تعذر العثور على نوع مقالة مطابق» في الميزة ويمكنهم إما اختيار أقرب نوع موجود أو الخروج دون توجيه." 8598858 wikitext text/x-wiki 32smmq3463f4590tskem1s9z309obbh 1198 2472704 8598860 2026-09-10T11:31:11Z Dyolf77 (WMF) 17171605 Created page with "هل يمكنني جعل مخطط واحد يغطي موضوعًا واسعًا جدًا، بحيث لا يضيع أي موضوع؟" 8598860 wikitext text/x-wiki 82qcp1pnriu006r9qomlr5gyrorbo06 1198 2472705 8598862 2026-09-10T11:31:25Z Dyolf77 (WMF) 17171605 Created page with "نعم، من الناحية التقنية يمكنكم ربط مخطط بمفهوم واسع في ويكي بيانات." 8598862 wikitext text/x-wiki gued254uqyq3ooqo8nnmn8w9xffngjl 1198 2472706 8598864 2026-09-10T11:31:42Z Dyolf77 (WMF) 17171605 Created page with "ولكن نظرًا لأنه يغطي نطاقًا كبيرًا، فإن النصائح التي يمكن أن يقدمها ستكون عامة بالضرورة." 8598864 wikitext text/x-wiki h87co7eoc5iukktb2blrlqu8io04lx6 1198 2472707 8598866 2026-09-10T11:32:12Z Dyolf77 (WMF) 17171605 Created page with "'''من الأفضل الاستمرار في إنشاء مخططات محددة بمرور الوقت بدلاً من الاعتماد على مخطط واحد شامل'''، لأن القواعد تختلف بين أنواع المقالات المختلفة." 8598866 wikitext text/x-wiki dvq8jel7k1sedgyux4wtmjli402tzcv 1198 2472708 8598884 2026-09-10T11:41:36Z Dyolf77 (WMF) 17171605 Created page with "== الترميزات في المخططات ==" 8598884 wikitext text/x-wiki exllfd9pydfniq3bllo4wuvkm1g2svh 1198 2472709 8598888 2026-09-10T11:42:12Z Dyolf77 (WMF) 17171605 Created page with "تستخدم ميزة إرشاد المقالات هذه المخططات في مراحل مختلفة من إنشاء المقالة الجديدة." 8598888 wikitext text/x-wiki me56p7ob6giub77wqrr0d9hyttbe4no 1198 2472710 8598890 2026-09-10T11:42:22Z Dyolf77 (WMF) 17171605 Created page with "يمكن تكييف المخططات من مخططات موجودة،" 8598890 wikitext text/x-wiki f442wht3zr8c9g7dyvd87dyphjfpla2 8598896 8598890 2026-09-10T11:43:10Z Dyolf77 (WMF) 17171605 8598896 wikitext text/x-wiki bcaf39ul9div8p6awl1ptqa5p8611hn 1198 2472711 8598892 2026-09-10T11:42:30Z Dyolf77 (WMF) 17171605 Created page with "مثل تلك الموجودة على [$1 هذه الصفحة]." 8598892 wikitext text/x-wiki 3owzbprhlkt80yisyvxtv913m6mh10r 8598898 8598892 2026-09-10T11:43:22Z Dyolf77 (WMF) 17171605 8598898 wikitext text/x-wiki nlh9ih3u7dqer9brcqjsanbovh131xo 1198 2472712 8598894 2026-09-10T11:42:40Z Dyolf77 (WMF) 17171605 Created page with "يمكن أيضًا إنشاؤها من الصفر باستخدام الترميزات المطلوبة كما هو موضح في مخطط موجود." 8598894 wikitext text/x-wiki nlh9ih3u7dqer9brcqjsanbovh131xo 8598900 8598894 2026-09-10T11:43:38Z Dyolf77 (WMF) 17171605 8598900 wikitext text/x-wiki jy76byl2dsnk3wek1qiiid1monho5i9 1198 2472713 8598903 2026-09-10T11:43:47Z Dyolf77 (WMF) 17171605 Created page with "علامة" 8598903 wikitext text/x-wiki jqypl4fm0gmpjqh32yek1hbjmnguam8 1198 2472714 8598905 2026-09-10T11:43:58Z Dyolf77 (WMF) 17171605 Created page with "تشير إلى الاسم الذي سيُستخدم عند عرض المخطط." 8598905 wikitext text/x-wiki 0oc27y2fwq0jw7hq7jfnycpiok60mjw 1198 2472715 8598907 2026-09-10T11:44:07Z Dyolf77 (WMF) 17171605 Created page with "افتراضيًا، تُسمّى المخططات مثل عنصر ويكي بيانات المرتبط بها." 8598907 wikitext text/x-wiki t2usdfam2pof1qjawr48kxn2ek4nm4t 1198 2472716 8598909 2026-09-10T11:44:40Z Dyolf77 (WMF) 17171605 Created page with "تتيح خاصية «العلامة» للمجتمعات تحديد اسم مختلف أكثر توافقًا مع ممارساتها." 8598909 wikitext text/x-wiki h9fng4r4ajuvqrujklslny9v40aqio0 1198 2472717 8598911 2026-09-10T11:45:13Z Dyolf77 (WMF) 17171605 Created page with "على سبيل المثال، يمكن لمخطط عنصر ويكي بيانات Q5 («إنسان») استخدام خاصية «العلامة» ليُعرض باسم «سيرة» بدلاً من ذلك." 8598911 wikitext text/x-wiki 0543rgfg3loh5q4i31lact5dd2unj9h 1198 2472718 8598915 2026-09-10T11:45:55Z Dyolf77 (WMF) 17171605 Created page with "في هذه الحالة، $1 + $2 + $3 يشير إلى أنه لا يمكن إنشاء هذه المقالة إلا إذا كانت موجودة في ويكي بيانات، وإذا كانت موجودة في 5 ويكيات أخرى بلغات أخرى، وأن هذين القيدين ينطبقان فقط على المحررين المبتدئين، وليس المحررين المتمرسين." 8598915 wikitext text/x-wiki 4ayizucfwcjvyisqqneysha7t99unk1